KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_3779Help
Entry
YPC_3779          CDS       T01874                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YPC_3779 (holC)
   00240 Pyrimidine metabolism
    YPC_3779 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YPC_3779 (holC)
   03430 Mismatch repair
    YPC_3779 (holC)
   03440 Homologous recombination
    YPC_3779 (holC)
Enzymes [BR:yph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YPC_3779 (holC)
DNA replication proteins [BR:yph03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     YPC_3779 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3638419..3638868
Genome map
AA seq 149 aa AA seqDB search
MKNATFYLLEHDTPAGELRAHEALACEIAAERWRAGKRVLIACESQEQAQRLDEALWQRA
PEQFVPHNLAGEGPKYGAPVELAWPERRGNSPRDLLISLLPEFAGFATAFHEVVDFVPYE
ENLKQLARDRYKSYRSVGFHLTTATPPTN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgctaccttctacctgctcgaacacgacacgcctgccggtgagctgcgagcg
cacgaagcgttggcctgcgagatcgcggctgaacgttggcgtgcgggcaagcgggtgttg
atcgcctgtgaaagccaggaacaagctcagcggctggatgaagcgctctggcagcgcgct
cctgaacaatttgtgccacataatctggccggtgaagggccaaaatatggcgctcccgtc
gaactggcgtggccggaaagacgcgggaattcaccgcgcgacctgcttatcagcctgctg
ccagaattcgcaggttttgccaccgctttccatgaagtggtagacttcgtgccttatgaa
gaaaatttgaaacagttggcgcgcgaccgatataaatcttatcgcagcgtcggcttccac
ttgaccacggcaacgccgccaactaattga

DBGET integrated database retrieval system