KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_4062Help
Entry
YPC_4062          CDS       T01874                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:yph00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:yph00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3929166..3930653
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLFAPWGLDVPERALREMTLDSRIAAAGDLFVAVVGHQTDGRRYIPQAIAQGV
AAIVAEADGVAPDVSVAEIHGVPVIYLRNLNQHLSTLAGQFYHQPGAALRLVGVTGTNGK
TTTTQLLAQWSQALGETSAVMGTVGNGLLGQVIPTENTTGSAVDIQHLLRNLVDQGATFA
AMEVSSHGLIQDRVAALSFAAVVFTNLSRDHLDYHGNMTSYEAAKWLLFSTHQSEHKIIN
ADDDVGRRWLSQLPQAVAVSMAGNVPKGWNGPWLSANKVIYHDNGASIAFDSSWGEGELE
SRLMGAFNVSNLLVALATLLVQGYPMAQLLAAAPHLQPVCGRMEVFNAPGKPTVVVDYAH
TPDALEKALAAARLHCTGKLWCVFGCGGDRDKGKRPLMGGIAEQLADCVVVTDDNPRSEE
PQAIVADILSGLLDAGRVQAIHGRAEAVTSAIMQAKEDDVVLIAGKGHEDYQLVGNRRLD
YSDRVTVARLLGGQA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacttattcgctccttgggggctagacgtcccggagcgg
gcgctacgggaaatgacattagacagccgtattgcagctgccggcgatttatttgttgcg
gttgttggccaccagacggatgggcgtcgctacatcccgcaagctatcgcccagggtgtg
gctgcaattgtggccgaagccgatggtgtcgcaccggatgtcagcgttgccgagatacat
ggcgtccctgttatttatttgcgtaatttgaatcagcacttatccacgctggctgggcag
ttttaccatcagcctggcgccgcattgcgtttggtcggtgtaaccggaacgaatggcaaa
accaccactacgcaattgttagcacaatggagccaggcgctgggcgaaaccagtgcagtc
atgggcaccgtaggtaatggtttattagggcaggtgatacccacggagaacaccaccggt
tctgccgtagatattcaacatttgctgcgtaatctggttgatcaaggtgcgacttttgcc
gccatggaagtttcttcccacggtttgattcaagaccgtgttgctgcgttatcctttgca
gccgtagtgttcactaacttaagccgcgatcatctggattatcacggcaatatgacgagc
tatgaggcggccaaatggctgctgttctccactcatcagtccgaacacaaaattatcaat
gctgatgatgacgttggccgccgttggttaagccaattgccgcaggctgtcgccgtcagc
atggcaggcaatgtccccaaaggctggaatggcccgtggttatctgccaacaaggtgatt
tatcacgataatggtgccagcatcgcgtttgattcaagctggggcgaaggcgagctagaa
agccgtctgatgggcgctttcaacgtcagtaacttgttggtggcattagcgacgttactg
gttcaggggtatcccatggcgcagttgttagctgcagcgcctcatctgcaaccggtttgt
gggcgtatggaagtgtttaatgcgccgggtaaaccaaccgttgtggtggattatgcccac
acgccagatgcattagaaaaagccttggccgccgcccgtttacattgcaccggcaagctg
tggtgtgtgtttggctgtggcggtgaccgtgataaaggtaagcgcccacttatgggcggt
atcgcagaacaactggctgactgtgtcgtggtgaccgatgataacccacgcagtgaagag
ccacaggcgattgttgctgacattctcagtggcttgctggacgcggggcgtgtgcaggcg
atacatggccgtgccgaagccgtaaccagtgccattatgcaagccaaagaagacgacgtt
gtcctgattgccggtaaaggccatgaagattatcaattagttggcaatcgtcgcttggat
tattcagaccgtgtcaccgtcgcgcgtttgttaggggggcaggcatga

DBGET integrated database retrieval system