KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_4395Help
Entry
YPC_4395          CDS       T01874                                 

Definition
putative carbohydrate kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPC_4395
Enzymes [BR:yph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YPC_4395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4254739..4255668
Genome map
AA seq 309 aa AA seqDB search
MSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAVQAVRLGAEVAYAGVV
GDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARNVIVVDMGANKLFTPAL
VDSALSQLKQSNVVLTQLEIPLETARYGLQRAKEFGKITILNPAPARDLRGLDLSAIDYL
TPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGESGSAVFGRNDTQEIPPCI
IDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALCCMDWETVPSYRYREDVDAF
MRSITVKEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttattctcggcagctatgcgaaagcgctggtgatgaccaccgaccgtatt
cctctggctggggaaacgctgattggctatgactttcgccagacgtggggcggtaaaggc
tcggatatggcggttcaggcagtgcgtctgggggcagaggtcgcctatgcgggtgtcgtc
ggtgatgacacctttggccatgaatttgtcggcttgatgcaggaagaaggcgtcaatatc
gacgcattaaccatcagcggagaattaccaacgggggcgggacttatcgttaaagataaa
gaagcccgtaacgtgattgtcgtggatatgggggccaataaactgtttaccccagcgttg
gtggacagcgccttatcccagctcaaacaaagcaatgtggtgctcacacagcttgaaatt
ccgctggaaacggcacgttacggactccaacgggcaaaagaattcggcaaaataaccatc
ctgaacccggctccggcaagggatctgcgcggtctcgatctcagcgcgattgattatttg
acccctaatgaaacggaagcccgcgtggctctgggtctgcctccggatgacccacgcagc
aaccgagagattgccaacctcttactggaaaccggttgccaatatgtcgtgatgacgctg
ggtgaatcaggttctgcggtatttggtcgcaacgacacacaagaaatccccccctgcatc
attgatgtcgtcgacagtaacggtgcaggtgacagctttaacgcggcactggccgtcgcg
ctggatgaagggctgccgattagcgaagctgtgctgtttgctaacgccacggcggcgttg
tgctgtatggattgggaaacggttccgtcctatcgctaccgcgaagatgtcgatgctttt
atgcgatctataaccgtgaaagaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system