KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0041Help
Entry
YpsIP31758_0041   CDS       T00570                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00230  Purine metabolism
ypi01100  Metabolic pathways
Module
ypi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YpsIP31758_0041 (gmk)
Enzymes [BR:ypi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     YpsIP31758_0041 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase ABC_tran AAA_22 AAA_18 AAA_33 cobW MMR_HSR1 Viral_helicase1 AAA_29
Motif
Other DBs
NCBI-ProteinID: ABS47282
UniProt: A0A0U1QXB7
Position
complement(49837..50460)
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVSEK
EFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDIDWQGAQQIRAKMPTARS
IFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHYAEYDYLIVNDDFNLALSDLK
TIIRAERLRLGRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggtacgctatacatagtttccgcgcccagcggggcagggaaatcaagcctg
attcaggctttgttaaaaacacaaccgctgtacgacacgcaggtttcaatttcccatacc
acgcgtgctaaacgtccaggggagaatcacggcgagcattacttctttgtttctgaaaaa
gagttttgccagatgattgatgatgatgcttttcttgagcatgccaaagtatttgaaaat
tactacggtacctcacgtctggctattgagcaggttcttgcaaccggggttgatgtcttt
ttagatattgactggcaaggagcgcaacagattcgcgcaaaaatgccaaccgctcgcagt
attttcatcttgccgccatccaaaacagaattggatcgccgtttacgcggtcgtgggcag
gatagcgaagaagttatcgctaagcgtatggagcaagctgtcgcagagatggcccattac
gcagagtatgattatttaatcgtaaatgatgatttcaatctggctttgtctgatctgaaa
accattattcgcgcagaacgactgcgtttaggccgccagaaacagcggcatgacgcttta
atcagcaaattattggcggactga

DBGET integrated database retrieval system