KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_0217Help
Entry
YpsIP31758_0217   CDS       T00570                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ypi00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ypi00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ypi00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ypi00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
244426..245304
Genome map
AA seq 292 aa AA seqDB search
MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAMLQDHDNPFLLYPYETNYL
LYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIAGDNSLLGASYTQRSWWQA
SNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGFNHQSNGKADPTSRSWNRVYT
RVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYYRLKVGYALGDSVFSLDGRYNWN
TGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTRVGVGIMLNDVL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcgagattttggcagatactgattgcgttattactggtgccaacattggcacaggct
gaagaagcaacgattgaaaagattcatgatgcgcccgcagtgcgtggcagtattatcgcg
gcaatgttgcaggaccacgataatcctttcctactttatccgtatgaaaccaactatttg
ctctacacctataccaacgagatcaataaacaagccattagctcgtatgattgggctgaa
caggcgaataaagatgaagtaaaattccaactgagtttagctttccctatctggcgtggt
attgccggggataactcattattgggggcttcttatacccagcgttcatggtggcaggca
tccaacagtgaagaatcttcaccttttcgtgaaaccaactacgagccacagctgtttttg
gcgtggtcaacagattacgaattggctggctggactttccgcgaagtcgaatttggtttt
aaccatcaatccaacggtaaagctgacccaacctcacgtagttggaaccgtgtttatacc
cgcgtgatggcacaacgtggcaatttggaaatcgacctgaagccttggtatcgtattcct
gaaagcgacagtaaagatgataaccctgatattacgaaatacatggggtattatcgcctg
aaagtcggctatgccctgggtgacagcgtattcagccttgatggtcgctataactggaat
accggttacggtggcgcggaaatgggctggagctacccaattaccaaacatgttcgcttc
tatactcaggtattcagtggctacggtgagtcaatgattgactataactttaggcaaaca
cgggtgggtgtaggtatcatgttgaacgatgtcctttaa

DBGET integrated database retrieval system