KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_0217Help
Entry
YpsIP31758_0217   CDS       T00570                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YpsIP31758_0217
   00565 Ether lipid metabolism
    YpsIP31758_0217
   00590 Arachidonic acid metabolism
    YpsIP31758_0217
   00591 Linoleic acid metabolism
    YpsIP31758_0217
   00592 alpha-Linolenic acid metabolism
    YpsIP31758_0217
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     YpsIP31758_0217
    3.1.1.32  phospholipase A1
     YpsIP31758_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244426..245304
Genome map
AA seq 292 aa AA seqDB search
MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAMLQDHDNPFLLYPYETNYL
LYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIAGDNSLLGASYTQRSWWQA
SNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGFNHQSNGKADPTSRSWNRVYT
RVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYYRLKVGYALGDSVFSLDGRYNWN
TGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTRVGVGIMLNDVL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcgagattttggcagatactgattgcgttattactggtgccaacattggcacaggct
gaagaagcaacgattgaaaagattcatgatgcgcccgcagtgcgtggcagtattatcgcg
gcaatgttgcaggaccacgataatcctttcctactttatccgtatgaaaccaactatttg
ctctacacctataccaacgagatcaataaacaagccattagctcgtatgattgggctgaa
caggcgaataaagatgaagtaaaattccaactgagtttagctttccctatctggcgtggt
attgccggggataactcattattgggggcttcttatacccagcgttcatggtggcaggca
tccaacagtgaagaatcttcaccttttcgtgaaaccaactacgagccacagctgtttttg
gcgtggtcaacagattacgaattggctggctggactttccgcgaagtcgaatttggtttt
aaccatcaatccaacggtaaagctgacccaacctcacgtagttggaaccgtgtttatacc
cgcgtgatggcacaacgtggcaatttggaaatcgacctgaagccttggtatcgtattcct
gaaagcgacagtaaagatgataaccctgatattacgaaatacatggggtattatcgcctg
aaagtcggctatgccctgggtgacagcgtattcagccttgatggtcgctataactggaat
accggttacggtggcgcggaaatgggctggagctacccaattaccaaacatgttcgcttc
tatactcaggtattcagtggctacggtgagtcaatgattgactataactttaggcaaaca
cgggtgggtgtaggtatcatgttgaacgatgtcctttaa

DBGET integrated database retrieval system