KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_0221Help
Entry
YpsIP31758_0221   CDS       T00570                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YpsIP31758_0221 (pldB)
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YpsIP31758_0221 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248864..249859
Genome map
AA seq 331 aa AA seqDB search
MNNWLTREEQFAAFVNGPLLDFWQQRDEQVFIGVDNIPIRYVRFCAPHHTRVVVVVPGRI
ESYIKYPEVAYDLFQQGYDVMVLDHRGQGRSGRMLDDHNRGHVIKFDDYIDDFTQLVQLE
ITGSHYQQRFALAHSMGGAILTRFLAKEPNVFNAVALCAPMFGIHLPLPGWLAHCIVNWA
EGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRRYLRQYSDTPEIRVGGPTYHWLRES
LLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHDAFSQAMTLAGHPCEGGGPQVIQGAR
HEILFERDTLRAEALSAILRFFAQHQSSVGH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataattggttaacccgagaagagcaatttgctgcttttgttaatgggccattgttg
gatttttggcagcaacgagacgaacaagtgtttatcggggtcgataatatccccattcgc
tatgtccgtttttgcgcaccgcaccatacccgtgtggtggtcgtggtgccaggtcgtatc
gagagttacatcaaataccctgaagttgcttatgatctgttccagcaaggctatgatgtt
atggtgctggatcatcgtgggcaagggcgttcagggcgtatgctggatgatcataaccgt
ggtcacgtgattaaattcgatgattatattgatgattttacacaactggtgcagctcgaa
attaccggtagccattatcagcagcgttttgcgctggcccactcaatggggggcgcgatc
ctgacgcgttttctagccaaagagcctaatgtatttaatgccgttgcgttatgtgcgccc
atgtttggtattcatttacccctgccgggctggttggcacactgcattgttaactgggct
gaagggcaccagaagctacgggattattacgcgattggtacagggcactggcggccactg
ccgtatttggtcaatatgctgactcacagccgcgagcgttatcgccgctatttgcgccaa
tattcagacacacccgaaatccgcgtgggtggccccacttaccattggctacgtgaaagt
ttgctggtgggggagcaaattattgctgaagcggagaaaatcaccactccggtattattg
ttacaggccagtgaggatcgggtggttcataacccagcccacgatgctttttctcaggca
atgacattggcagggcacccctgtgaaggggggggacctcaggtcattcaaggtgcacgc
catgagatcctgtttgagcgggacacgctgcgtgccgaggcgcttagcgccatattgcgc
tttttcgcgcaacatcaatcatcagtcggccattag

DBGET integrated database retrieval system