KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_0295Help
Entry
YpsIP31758_0295   CDS       T00570                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YpsIP31758_0295 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YpsIP31758_0295 (aceA)
Enzymes [BR:ypi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YpsIP31758_0295 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
333293..334600
Genome map
AA seq 435 aa AA seqDB search
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHG
GSRKGYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctctcgtactcaacaaattcagcagttggaacaggaatggacatcgccgcgc
tggaaaaatatcactcggccttatagcgccgaagatgtcatcaagctgcgtggttcggtc
aatccagaatgtacgttcgcacaaaatggtgccaaaaaactgtgggaattgctgcacggc
gggtcgcgtaaagggtatatcaactgtctgggggcattaaccggtggtcaggcgctacaa
caggcgaaagccggtgttgaagccatttatctgtcgggatggcaggtggcggctgatgct
aatacggcatctagcatgtatccagatcagtcactgtatccggtcgactctgtgcctgcg
gtggtgaaacgtatcaacaatagcttccgccgcgctgatcaaattcagtggtcgaataat
attgagccaggtagtaaaggctataccgactatttcctaccgatcgtcgcggatgcggaa
gcgggttttggcggtgtgctgaacgcgtttgaattaatgaaagcgatgattgaagcgggg
gcggcaggggttcattttgaagaccaattggccgcagtgaaaaagtgtgggcatatgggc
ggtaaggtactggtgccgacacaagaggccattcaaaagctggttgctgcccgtttagcc
gcagatgtcttgggtgtaccaacgctgttgattgccaggactgatgcggatgcggctgat
ttattgacctcagattgcgacccctatgaccgggagtttattaccggcgaccgtactgct
gaaggttttttccgcacccgtgccggtattgaacaagcgatcagccgtggcctggcgtat
gccccttatgctgatttggtgtggtgtgaaacctcgacacctgatctggctctggccaaa
cgttttgccgatgctgttcatgctcaattccccggaaaattactggcttataactgttca
ccctcctttaactggaagaagaatctgaccgaccagcaaattgccagcttccaggatgaa
ctctccgccatgggctacaaataccagtttattacgctggcgggtattcatagcatgtgg
ttcaacatgttcgatctggcccatgcgtatgcgcagggtgaaggcatgaaacactacgtt
gagaaagtccagcaacctgagtttgcttctgtggaccgcggctacacctttgcttcccat
cagcaagaagtggggactggctacttcgataaagtcaccaatattattcaggggggcgca
tcatctgtaacggcactgaccggttcgacggaagagcagcagttttag

DBGET integrated database retrieval system