KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_0436Help
Entry
YpsIP31758_0436   CDS       T00570                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ypi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ypi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(513566..514501)
Genome map
AA seq 311 aa AA seqDB search
MANPLYHKHIISINDLSRDELELVLRTAASLKKTPQPELLKHKVIASCFFEASTRTRLSF
ETSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIVMRHPQEGASRLAAQFS
GNVPIVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGDLKYGRTVHSLTQALAKF
NGNRFFFIAPDALAMPAYILQMLEEKEIEYSLHESLEEVVPELDILYMTRVQKERLDPSE
YANVKAQFILRSSDLTGARDNLKVLHPLPRIDEITTDVDKTPYAYYFQQAGNGIFARQAL
LALVLNAELAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccgttgtatcacaaacatatcatctcaattaacgatttaagtcgcgatgaa
ctagaactggtcttgcgtactgcggccagcctgaaaaagactccgcagccagagttgtta
aaacataaagtgatcgccagttgcttttttgaagcgtcgacccgcacccgcttgtcattt
gaaacatccattcaccgcctgggtgcctcggtcgtgggcttttctgatagcagcaatacc
tcattgggtaagaaaggcgagacactggcagacaccatgtcagtcattagcacttatgtt
gacgccattgtgatgcgccatccacaagaaggggcttcacgtctggccgcgcaattctcg
gggaatgtgcctatcgtgaatgccggtgacggcgcaaaccagcacccaacacaaaccctg
ctcgatttattcactattcaggaaacgcagggccggctggataacatcaatatcgccatg
gtaggtgacctgaaatatggccgtaccgtgcattcattgacgcaagcgctggcaaaattc
aatggcaaccgcttcttctttatcgcccctgatgcgctggcaatgcccgcttatattttg
caaatgttggaagaaaaagagattgagtacagcctgcatgaaagcctcgaagaggtggtg
ccggagttagatattctctatatgactcgcgtacagaaagagcgccttgacccatcggaa
tatgccaatgtcaaagcacagtttattttgcgctcttctgatttaacgggcgcacgggat
aatcttaaagtgttgcacccgctgccacgtattgacgaaatcacaaccgatgtcgataaa
accccctacgcctactatttccaacaagcgggtaacggtatttttgcacgtcaagcgcta
ctggcactggtattaaacgcagaattagctctttaa

DBGET integrated database retrieval system