KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_0454Help
Entry
YpsIP31758_0454   CDS       T00570                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ypi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ypi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
527713..528975
Genome map
AA seq 420 aa AA seqDB search
MDKFRVQGRTRLSGEVTISGAKNAALPILFAALLAEEPVELQNVPKLKDIDTTIKLLSQL
GTKIERNNGSVFVDASAVNEFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGA
RPVDLHITGLEQLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGT
TVIENAAREPEIVDTANFLNTLGAKISGAGTDRITIEGVTRLGGGVYRVLPDRIETGTFL
VAAAISGGKVVCRQTRPDTLDAVLAKLREAGADIEVGDDWISLDMQGKRPKAITFRTAPH
PGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICYGVEQ
LSGAQVMATDLRASASLVLAGCIAEGVTIVDRIYHIDRGYERIEDKLRALGAKIERVKGE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggataagtttcgtgtgcaggggcggactcgcctgagcggtgaagtcactatttccgga
gcgaaaaatgctgcgttaccgatattgtttgcagcattgttagcagaagagccggtagag
ctacaaaatgtcccaaagctaaaagacattgataccaccattaagttgctcagccagtta
ggcaccaaaattgaacgtaataatggttccgtttttgttgatgccagcgctgttaatgag
ttttgtgcgccttacgatttagtgaaaacgatgcgtgcctctatttgggcgttggggcca
ctggttgcccgttttggccaaggtcaggtttctttgcctggtggttgtgcgattggcgca
cgtccggttgatttgcacatcacgggtctagaacaactgggtgctgaaatcaagctggaa
gaaggctacgttaaggcctccgttaatggccgcctaaaaggtgctcatatcgtgatggat
aaagtcagcgtgggtgcgacggtgactatcatgagtgcggcaacactggcggaagggacg
accgtgattgaaaatgcggcccgtgaaccagagattgttgatacggcgaacttcctgaat
acgctgggtgctaaaatcagtggtgccggtactgaccgcattaccattgagggggttacc
cgtttaggggggggcgtataccgtgtgctacctgaccgcatcgaaaccggtactttcctg
gttgccgcagccatttcaggtggcaaagtggtgtgccgccaaacacgccctgacacgctg
gatgctgtcttggctaaactgcgcgaagcaggtgctgatattgaagtcggtgatgattgg
atcagtctggatatgcagggtaaacgccctaaagccattacctttcgtaccgcgccacac
cctggcttcccaacggatatgcaggcccaattcagtttattgaatctggtggctgaagga
acgggtgtcatcactgaaaccattttcgaaaatcgttttatgcacgtcccagagcttatt
cgaatgggcgcacatgcagaaatcgagagcaataccgtgatttgctatggcgttgaacaa
ctttctggtgctcaggttatggcaaccgatttacgtgcttccgccagcctggtattagcc
ggttgtatcgctgaaggcgtaacaatcgttgaccgtatttatcacatcgatcgtggctac
gaacgtattgaagataaactgcgggcgctgggtgcgaagattgaacgcgtgaaaggcgag
taa

DBGET integrated database retrieval system