KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_0918Help
Entry
YpsIP31758_0918   CDS       T00570                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ypi00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1101637..1103697
Genome map
AA seq 686 aa AA seqDB search
MSKFPPLSAKVSALLHGADYNPEQWENYPDIIDKDIAMMKQAKCNVMSVGIFSWVKLEPS
EGEYNFSWLDELIEKLYAAGIHIFLATPSGARPAWMSQKYPEVLRVGRDRVPALHGGRHN
HCMTSPVYRQKVRQINQKLAERYAHHPAVIGWHISNEYGGECHCHSCQQKFRLWLQDRYQ
TLDNLNEAWWSAFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQVTEFCSEEAKP
LKAANPELPVTTNFMEYFYDYDYWKLAQVIDFISWDSYPMWHREKDETQLACYTAMYHDL
MRTLKQGRPFVLMESTPSATNWQPTSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVSELGRILEAMSPVMGSKVDADVAIIFDWESRWAMDDA
EGPRNCGLEYEKTVAEHYRPFWERGIAVDIINADCDLSGYKLVIAPMLYMVREGFAERAT
RFVEQGGQFVATYWSGIVNESDLCHLGGFPGPLRPLLGIWSEEIDCLADGESNQVQGLAG
NKAGLQGPYQAIHLCDLIHLEGATAVARYRDDFYADRAAVTVNFVGEGKAWYVASRNDAA
FQRDFFMNIAEELNLARALDTQFPYGVTAHRRTDGESEFIVVENYSNDSKSLVLPAVYRD
MVDQQPVQGSLTLAPWGSRVLTRYLE
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtttccgcccttaagcgcgaaagtttctgcgttattgcatggcgctgactat
aacccagagcaatgggaaaattatcctgacattattgataaagatattgccatgatgaaa
caggcaaaatgcaatgtcatgtcagtgggaatattcagttgggtaaaacttgagccaagt
gaaggagaatataatttctcttggttagatgaattaattgaaaaactttatgctgccggt
atccatatattcctggcgacgccaagtggcgcacgtccggcttggatgtcgcagaaatat
cctgaagttttacgtgtcgggcgtgatcgggtgcctgcgctgcatggtgggcgtcataac
cactgtatgacctcgccggtatatcgccagaaagtgcggcagataaaccagaagttagca
gagcgttacgcccatcatcctgcggttattggctggcacatctctaatgaatacggcggc
gaatgtcactgtcattcctgtcagcaaaaattccgcctctggcttcaggatcgttatcaa
acgctggataaccttaacgaagcctggtggagtgctttctggagccacacctacagcgat
tggtcgcaaattgagtctccagcaccgcaaggtgaagtttcaattcatggtctgaacctt
gactggcggcgttttaataccgctcaggttacggagttttgttctgaagaagcgaagcca
ctaaaggcggcaaacccagagttgcctgttacgactaactttatggagtacttctacgat
tacgactactggaagttggcgcaggtgattgattttatctcctgggacagctacccgatg
tggcatcgtgagaaagatgaaacgcagcttgcctgttataccgcgatgtatcatgacctc
atgcgtaccctgaaacagggccgtccatttgtcttaatggaatcaacgccgagcgcgacc
aactggcaacctaccagtaagttgaagaagccggggatgcatatcctctcttctttacag
gctgtcgcgcacggtgcggatgcggtgcagtatttccaatggcgtaagagccgtggctcc
gttgagaaattccacggtgcggttgtcgatcatgttggtcacattgatacccgtgttggg
cgggaggtgagcgaactgggtcgtatactcgaggccatgtcgccggtgatgggaagtaaa
gtagacgctgatgttgccatcatttttgattgggaaagtcgttgggctatggacgacgcc
gaaggcccacgtaactgtggcttggaatatgagaaaaccgttgccgagcattaccgtcca
ttctgggaacggggcattgcggtcgatatcattaatgctgactgcgatctgtcgggttac
aagctggtcattgcgccgatgctctatatggttcgtgaagggtttgctgaaagggcgacg
cgttttgtagagcaaggtgggcagtttgtcgcgacctactggagcggtattgtcaacgaa
tctgacctgtgtcatctcggtggcttccctggccctctgcggccgctgttgggtatctgg
tccgaagaaattgactgtctggccgatggcgagagcaatcaagtccaagggcttgcaggc
aataaagccggtctacaggggccttatcaggccatccatctctgcgatttgattcatctt
gaaggggcgacagccgtcgcgcgctatagagatgacttctatgctgaccgtgcggcggtg
accgtaaactttgttggcgaaggtaaagcctggtatgtcgcttcacgtaacgatgcggct
ttccagcgtgatttcttcatgaacattgccgaggagctaaacttggcacgtgcgctagac
acccagttcccttatggggttaccgctcaccgtcgtaccgatggtgagagtgaatttatc
gtggtagaaaactacagtaatgacagcaaatcgctggtgttacctgcggtataccgcgat
atggtcgaccagcagccggtacaaggtagcctgacgcttgccccatggggaagccgagtg
ctaactcgctatctcgaataa

DBGET integrated database retrieval system