KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_0992Help
Entry
YpsIP31758_0992   CDS       T00570                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ypi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1190434..1192407
Genome map
AA seq 657 aa AA seqDB search
MMTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVGAGHVCLPLRYLQPEL
LFGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPLVLQQERLYLQRMWQYE
GDVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALFGYAGSEVDWQKVAAAVA
ATRRISVISGGPGTGKTTTVAKLLTALIRISQGQRLRIQLAAPTGKAAARLTESLGKAIR
QFSLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMAR
LIAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGYSEQRAQQLTQLTGYLLTNNA
LTSNVLASNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYRFDEKSGIGQLALAVNA
GEYRQALSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYLERVAALAPAAEVLAAFG
RYQLLCALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRWYVGRPVMIELNDSALGLF
NGDIGIALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVL
PNTFMPVLTRELVYTAITRARQHLTLYCSDAVLSHAIRTPTLRLSGLVDRLNTLNRQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctattggctcaggctgctcgagaccgcttattgcgcccactggatgtgcag
ttttcacgaatgattgccggcgatgatgacccgcggttacaactggccgcagcgatcctt
agtgcagaagtaggggccggtcatgtttgcctgccattacgctatttacagccagaactg
ctattcggtgggcggcaacccgatttatcactggcgctatggcaggcggcgggctcgcca
gataaagcacagtggctacaggcattacaaaacgccccagtagtcagtgatggctctcaa
ccaacaccattagtgctacagcaggaacgtttatatctgcaacgaatgtggcagtacgaa
ggagatgtcgtccaatttattgccagtgactctgtttttataaacagagatagtgatttt
atgaccagtaaaggtattgccacttctgttgatgaatcgctattacgggagacgctagac
gctttgtttggttatgctggtagtgaggttgattggcaaaaagtggcggcagcggttgcg
gctacccgtagaatttcagttatttccggcgggccgggcacggggaaaaccaccacagta
gccaaacttttgacagcattgatacggattagtcaggggcaacgtttacgtattcaactt
gcggccccaaccggtaaagccgctgcacgccttactgaatcactgggcaaagcgattcgg
caattctctcttactgatgatgaacgtaaattattccctgatcaggcttcgaccttgcac
cgtttactgggtgttcagcccaatagccagcgcctgcgttaccaccgtggtaatccatta
aatcttgatgtactggtcgttgatgaagcatcaatggttgatttacctatgatggcgcgc
ttaattgcggcattacctgccaaggccaaggtgatattccttggtgaccgtgaccaactg
gcctcggttgaggcgggggcggttctgggggatatctgccgttttgccgaattaggttac
agcgagcaacgggcacagcaattaactcagttaacgggctatttattaactaataatgca
ttaaccagcaatgtactagccagcaatgtactaaccaataaggcattagccaataaagcg
cagccagatgaaacctattctgattcagcgaatgtacgcgatagcctgtgtttactgcgt
aaaagttaccgcttcgatgaaaagtcagggattgggcagcttgctctggccgttaatgca
ggggagtatcggcaggctttatccgtattaaacagtgcgtattctgatgttgaacgcttc
ccgctggccgatgaggaagattatcaggtactgctagaggcttgtgctgtggggtatcag
cattacctcgaacgggtggctgcgttagcccctgcggcagaggtattggcagcatttggc
cgctaccaactgctgtgtgcattacgttccgggccattcggtgtcagtggcttaaacgaa
cgcattgaacaggttttacatcgtaaaggattcattatccgtccatcagggccttctggc
cgttggtatgttgggcggccagtgatgatagaacttaatgatagcgcacttggcttattc
aacggggatattggtattgccttacatgataatgaaggcgagctacgggtatattttcaa
ttgcccgatggcaatataaagtcagtacaacctagtcgccttcccagccatgaaaccgct
tatgctatgacggttcataaatcgcagggttcagagtttgaacacacagcattggtatta
cctaacacgttcatgcccgtgttaactcgtgaattggtctataccgccattacccgcgcc
cgtcagcatctgacgctttattgcagcgatgccgtgctaagtcatgccatacgtacaccg
actctccggctgagtgggctagttgatcgcttgaatacattaaatcgccaataa

DBGET integrated database retrieval system