KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_1400Help
Entry
YpsIP31758_1400   CDS       T00570                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YpsIP31758_1400 (fadJ)
   01212 Fatty acid metabolism
    YpsIP31758_1400 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YpsIP31758_1400 (fadJ)
   00650 Butanoate metabolism
    YpsIP31758_1400 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    YpsIP31758_1400 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    YpsIP31758_1400 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YpsIP31758_1400 (fadJ)
   00310 Lysine degradation
    YpsIP31758_1400 (fadJ)
   00380 Tryptophan metabolism
    YpsIP31758_1400 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YpsIP31758_1400 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YpsIP31758_1400 (fadJ)
   00281 Geraniol degradation
    YpsIP31758_1400 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    YpsIP31758_1400 (fadJ)
Enzymes [BR:ypi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YpsIP31758_1400 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YpsIP31758_1400 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YpsIP31758_1400 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1638962..1641205
Genome map
AA seq 747 aa AA seqDB search
MGASATNSVTHPAFTLNVRPDNIGIITIDVVGDKVNTLKAEFADQIATILQQAHALPKLQ
GLVIVSGKPDSFIAGADITMIAACRTAHDARVLAQKGQSILAQIAAFPVPVVAAIHGACL
GGGLELALACHSRICSLDDKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSKALDMILTGKQ
IRPRQALKMGLVDDVVPRDILLDVAIQRAKAGWLNRRALPWQERLLSGPLGKALLFRIVR
KKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGYEAEARAFGELAMSPQSAALRSLFFATT
SLKKETGSAATARAIHRVGVLGGGLMGGGIANVTATRAGLPVRIKDINPQGINQALKYTW
DALGKRVRSKRMRPTEQQRQMMLISGSTDYRGFERVDIVVEAVFEDLSLKQQMVADIERF
GAAHTIFASNTSSLPISQIAALAQRPEQVIGLHYFSPVDKMPLVEVIPHEKTSEETIATT
VALARKQGKTAIVVADRAGFYVNRILAPYINEAARCLLDGEPIESVDNALVDFGFPVGPM
MLLDEVGIDVATKIMPILVEQLGPRFAAPPSFDVILKDGRKGRKNGRGFYLYSNPTKNSS
PTKNGNSPAKRNSFKWRKNKVKPVDASIYTLLGVTPKAHLGAGVITQRCTMLMLNEAVRC
LDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYLDSLGADKVVQALRLLVQQYGERFEPCQ
RLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcatcggccacgaattcagttacccatcccgcatttaccctcaacgtaaggccg
gacaatattggcattatcaccattgatgttgttggtgacaaagtgaataccctaaaggct
gaatttgctgatcaaattgccactatattgcaacaagcgcacgctctaccaaaattacag
ggactcgtcattgtttctggcaaaccagactccttcattgccggtgcggatatcacgatg
atcgcggcttgtcgtaccgctcacgacgcccgcgtattagcacaaaaaggccaatcaatt
ttggcgcaaattgccgctttccctgtgccggttgtggctgcgattcatggcgcttgtctg
gggggagggctagagctggcgctggcttgccatagccgcatatgttctctggatgataaa
accgttctcgggctaccggaggtgcaactggggttactgcctggctccggcgggacgcaa
cgtctgccgcgtttagtgggggtcagtaaagcactggatatgatattgaccggtaaacag
atacggccccgtcaggcactaaaaatggggctggtggatgatgttgtgccacgcgatatc
ttattggatgtggcgattcagcgcgcgaaagcggggtggcttaatcgacgagcattacca
tggcaggagcgtttactcagtgggccgttgggtaaagctttattattccgtattgtccgt
aaaaaaacgctagctaaaacgcgggggcactacccggcggctgaacgtattattgatgtg
gtgcgtaaaggattagatcagggcgggccaagtggttatgaggcagaagccagagcattt
ggcgagttggcgatgtcgcctcagtcagccgcattacgcagcctgttttttgccacgacg
tcactgaaaaaagagaccggaagtgcagccacagcgcgtgcaattcatcgggtcggcgta
ttgggcggtggcttgatgggcggaggtattgccaacgtaacggctacccgagcgggcttg
ccagtgcgtatcaaagatatcaatccgcaaggaattaatcaggcgctgaaatatacctgg
gacgcattgggtaaacgggttcgtagtaagcggatgcgcccaactgaacagcagcggcag
atgatgttgatctctggtagtacggattaccgtggttttgaacgtgtcgatattgtggtg
gaagcggtatttgaggatttatcactgaagcagcaaatggttgctgacatcgaacgattt
ggtgccgcccatactatttttgcctccaatacatcatcactccccatcagccagattgct
gctttggcgcaacggccagagcaggttattggcctgcactattttagtccagtagataaa
atgccactggttgaagtcatcccccatgaaaaaaccagtgaagagaccattgctaccacc
gttgctttagcccggaaacagggcaaaacagccattgtggtggctgatcgcgctgggttc
tatgtaaaccgcattttggcaccttatattaatgaagctgcccgttgcctgctcgacgga
gagcctatcgaatcagttgataacgcgttggtcgattttggtttccctgttggccccatg
atgctgcttgatgaggttgggattgatgttgcgaccaaaataatgccgattctggtcgag
caattagggccgcgttttgctgcgcccccgtcatttgacgttattttgaaggatggacgt
aaagggcgcaaaaatggccgtggcttttatttatattcaaaccccacaaaaaattcatct
ccaacaaaaaatgggaattctccggcgaagcgtaatagctttaagtggagaaaaaacaaa
gtaaaaccagtcgatgccagtatctataccttgttgggggtgacacctaaagcccatctt
ggtgcaggcgtgattactcaacgttgtaccatgctgatgttgaacgaagcggtacgctgt
ctggatgaatcgatcattcgtaacccgcgcgatggtgatattggtgcagtgtttgggatc
ggttttccgcctttcctcggtggtccgttccgctatttggatagcctgggagccgataag
gtggtacaagcactcagattattggtacagcaatacggtgagcgtttcgaaccttgccag
cggttggtaacaatggctgaacaacaacaacaattctatcccgtggacgccaatatagat
gaggtgacggacgtggcaagctga

DBGET integrated database retrieval system