KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_1450Help
Entry
YpsIP31758_1450   CDS       T00570                                 

Definition
(GenBank) aminotransferase, class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00220  Arginine biosynthesis
ypi00250  Alanine, aspartate and glutamate metabolism
ypi00290  Valine, leucine and isoleucine biosynthesis
ypi01100  Metabolic pathways
ypi01110  Biosynthesis of secondary metabolites
ypi01130  Biosynthesis of antibiotics
ypi01210  2-Oxocarboxylic acid metabolism
ypi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YpsIP31758_1450
   00290 Valine, leucine and isoleucine biosynthesis
    YpsIP31758_1450
   00220 Arginine biosynthesis
    YpsIP31758_1450
Enzymes [BR:ypi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     YpsIP31758_1450
    2.6.1.66  valine---pyruvate transaminase
     YpsIP31758_1450
Amino acid related enzymes [BR:ypi01007]
 Aminotransferase (transaminase)
  Class I
   YpsIP31758_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABS49541
UniProt: A0A0U1R2N0
Position
complement(1689579..1690793)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLFSARKAIMQHYQARDIRDLTVEDIYIGNGVSELIVQSMQALLNLGD
EMLVPAPDYPLWTAAVSLSSGKAVHYMCDEESGWFPDLDDIRSKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQNDLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRDRAWELINQIPGVSCVKPQGALYMFPRIDQKRFNLKDDQKLVLDLLLQEK
VLLVQGSAFNWPYPDHVRIVTLPRVDELEMAVRKLGRFLETYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccattgagaaatccagcaaactggacaacgtctgttatgacattcgtggaccg
gtgctaaaagaagctaagcgtcttgaagaggaaggtaacaaggttctgaaactgaacatc
ggcaaccctgccccgtttggtttcgatgcacccgacgagattctggtggatgtaatccgt
aatttaccgaccgcacaaggctattgcgactccaaaggcttgttttcggcacgtaaagcc
attatgcaacactatcaagcccgcgatatccgtgatctgacggtcgaggatatctacatt
ggaaacggtgtttccgagttgatcgttcaatccatgcaagcattactgaatttgggtgat
gaaatgctggtacccgcaccggattacccgctgtggacagcagccgtgtcgctctcaagt
ggtaaagcggttcattatatgtgtgatgaagagtcaggctggttccctgatttggatgat
attcgcagcaaaatcactccgcgtacccgtgggattgtgattatcaacccgaataaccca
actggtgcggtatacagcaaagagctgctgttagaaattgttgaaatcgctcgccagaat
gacctgattattttcgctgatgagatctacgataagattttgtatgacgatgctcagcac
cattcgatcgccgcattagcccctgatttgctgaccgttacgttcaatgggctgtctaaa
acataccgtgttgcgggtttccgtcagggctggatggtgttgaacgggccgaaaaagcac
gctaaagggtatattgaaggcttggaaatgctggcgtcgatgcgtttgtgcgccaacgtg
ccaatgcagcatgcgattcaaaccgccttgggcggctatcagagcattagtgagtttatc
caacctggtggccgtttgtacgagcagcgtgatcgggcttgggagcttatcaatcaaatc
cccggtgtgtcctgtgtgaaacctcagggcgcgttgtatatgttcccacgtattgatcag
aaacgttttaacctgaaagacgatcagaagttggtattggatctgttgttgcaagagaaa
gtgctattggtgcaaggtagcgcctttaactggccgtacccggaccatgtgcggatcgtc
acgttgccacgggtggatgagctagagatggcggtgagaaagctggggcggttcttagag
acgtatcatcagtaa

DBGET integrated database retrieval system