KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_1592Help
Entry
YpsIP31758_1592   CDS       T00570                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YpsIP31758_1592 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    YpsIP31758_1592 (nagZ)
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YpsIP31758_1592 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1848362..1849393
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVRQIRAASHERLVVA
VDQEGGRVQRFRDGFTRLPAAQSFAAINDAATAAQLAQEAGWLMAAEMMAMDIDISFAPV
LDIGHVSAAIGERSFHSDPQQARIMAECFIRGMHSAGMKTTGKHFPGHGAVTADSHKETP
HDNRPLAEIRTHDMVIFRELIQRKLLDAIMPAHVIYTEADARPASGSAYWLQEILRQELG
FEGIIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPIKADQL
TRLYHSGQFDRQTLMASSRWQQANKALTALSERWDAHKQTLGQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcccgtgatgttagatgttgccagctatgagctggatgctgaagagcgtgagatt
ttaaaacacccactggtgggagggttgatcttattcagccgtaattttcatgatgcggag
cagttacgcgaattagtacgccaaatccgtgcagcatcgcatgaacgtttggtggtcgca
gtggatcaggaaggggggcgggtccaacgctttcgtgacggttttacccgcctgccagcg
gctcagtctttcgcggctatcaatgatgccgctactgcggctcaactggcgcaagaggcg
gggtggttgatggcagcagaaatgatggcgatggatattgatatcagttttgctccagta
ctggatattggccatgtcagcgccgcaattggtgagcgttcattccacagtgatccacaa
caggcgcggataatggcggagtgtttcatccgtgggatgcacagtgcagggatgaaaacc
acgggcaagcattttccagggcacggcgcagtaaccgcagattcacataaagagacgcca
catgataatcggccactggcagaaatccgtactcatgatatggttatatttcgtgaattg
atccagcggaaattactggatgcgattatgcctgctcacgtgatttataccgaagccgat
gcacggcctgccagcggttctgcctattggttacaagagatattgcgccaagagctaggg
ttcgagggcatcattttctctgatgatctctcgatggaaggggctgcgatcatgggcagt
tacgccgagcgcggccaggcatcgttggatgccggttgcgatatgattttggtgtgtaat
aaccgtcagggggccgtgagtgtgctggataatctgtctccgatcaaagccgaccaactg
acccgtttgtaccattcagggcaatttgaccgccagacattgatggcttcatcccgttgg
caacaggcgaataaagcattaacggcactcagcgaacgttgggatgcacataaacaaacg
ttggggcaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system