KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_1629Help
Entry
YpsIP31758_1629   CDS       T00570                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YpsIP31758_1629 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    YpsIP31758_1629 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YpsIP31758_1629 (lacZ)
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     YpsIP31758_1629 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1887718..1890918)
Genome map
AA seq 1066 aa AA seqDB search
MTSQEKVPFQVQLSLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQ
TLNGLWSFSYFTQPEAVPEHWVRCDLAEAKPLPVPANWQLHGYDAPIYTNIQYPIPVNPP
RVPDLNPTGCYSRDFTLEPSWLASGKTRIIFDGVSSAFYLWCNGQWVGYSQDSRLPAEFD
LTPYLQAGSNRIAVLVLRWSDGSYLEDQDMWRMSGIFRDVKLLHKPEIHLRDIHIMTHLS
PEFTSANLEVMAAVNIPSLQLNDPQVTGSYQLRVQLWLADKLVASLQQPLGTQAIDERGP
YTDRTQLVLRIDQPLLWSAEQPTLYRAVVSLLNHQQELIEAEAYDVGFRQVAIHQGLLKI
NGKAVLIRGVNRHEHHPQTGQAIDEESLLQDILLMKQHNFNAVRCSHYPNHPLWYRLCDR
YGLYVVDEANIETHGMQPMSRLSDDPSWFSAFSERVTRMVQRDRNHPCIIIWSLGNESGH
GATHDALYRWIKTNDPTRPVQYEGGGANTLATDILCPMYARVDEDQPFPAVPKWSIKKWV
GLPNESRPLILCEYAHAMGNSFGGFARYWQAFRQYPRLQGGFIWDWVDQSLTHHNDHGQP
YWAYGGDFGDTPNDRQFCMNGLVFPDRSPHPSLYEAQCAQQFFQFSLLSTTPLVINITSE
YLFRESDNEQLYWRIMLEGESMLEGSQPLNLSPESSQCYRLAEKLPTLNKPGQLWLNVEI
RQPKETPWSPAQHRSAWHQWRLPQPLFSPSSDLTNATAHYAPQLQHNLQLQHNRQLQHDL
QLQQDEQHIKVTYQQQCWQFSRQTGRLAQWWVADKPMLLRPLQDQFVRAPLDNDIGISEA
THIDPNAWVERWKKAGMYQLQQRCLSLHVDHLSHSVQISAEYGYEFEQEPLLHSHWVYRF
DRHGRMTIDVNVRIATSLPAPARIGMCCQLADISPTVDWLGLGPHENYPDRQLAAQYGHW
SLPLEQMHTAYIFPSENGLRCNTHTLNYGRWTLTGDFHFGISRYSTQQLMVTSHQHLLEP
EEGTWLNIDGFHMGVGGDDSWSPSVHIDDILTRETYQYQICWQYKV
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacaggaaaaggtaccattccaggtgcaactgagtcttccccagattttgtcc
cgccgagattgggaaaacccgcagatcacacagtatcatcgcctggaggcccacccgcct
tttcacagttggcgtgatgtagaatctgcccagaaggatcgtccttcaccacagcaacaa
acactcaatgggctatggtcattcagctatttcacacaacctgaagcggtacccgagcac
tgggtgaggtgcgatttagccgaggcaaagccgctccctgtaccggctaactggcaactt
catggttatgacgcaccaatttacaccaatatacaataccctattcccgtcaacccacca
cgggtcccggatctaaatccaacgggttgctattcccgtgatttcacgttagagccaagc
tggttggcatcgggtaagactcgcattatttttgacggtgtcagttctgcattttatctg
tggtgtaatgggcaatgggtaggttattcacaagacagccgcctacctgctgagttcgat
ctcaccccctatttgcaggctggcagtaaccgtatcgcagttttagttctgcgctggagt
gatgggagttatcttgaagatcaagatatgtggcgtatgagcggaatttttcgtgatgtg
aaattgttgcataaacccgagattcacttacgggatatccacatcatgacgcatctatcc
cctgaattcacctctgcaaatttagaggtaatggcggccgtcaatatcccctctctacag
ctcaatgatccgcaggtgaccggatcctatcagctccgtgtacaactttggttagccgat
aaattggtcgccagtttacaacagcctttaggcacccaagccattgatgaacgaggtcct
tatactgatcgtacccagctagtattgcgaatagatcagcctctgctctggagtgccgag
cagccgacgctataccgagccgtggtttccttgctcaatcatcagcaagaattgattgag
gccgaagcctatgacgtgggtttcaggcaagtggcaatccatcaaggcttgcttaaaatc
aatggcaaagcggtgctgatcagaggggtgaatcgacatgaacatcacccgcaaacaggt
caggccattgatgaagagagtctgttgcaagacattttattaatgaaacagcataatttt
aatgctgtgcgctgctcccactatcccaatcatcctttatggtaccgcctttgtgaccgc
tatggtttgtatgtggttgatgaagcgaatattgagacacacggtatgcagcccatgagc
aggctgtccgatgacccaagctggttttcagctttcagtgaacgggtgacgcggatggtt
cagcgagatcgcaaccatccatgcattattatctggtcactgggcaatgaatcaggccat
ggcgcaacccatgatgccctctatcgttggataaaaaccaatgaccccacccgccctgtg
caatatgaagggggcggtgccaacaccttagcgaccgacattctgtgtccgatgtatgcc
cgtgttgatgaagaccagccctttcctgccgtccccaagtggtcaatcaaaaaatgggtt
ggcttaccgaatgaatctcgccccttgatcctatgtgaatacgcccatgcgatgggcaat
agcttcggtggatttgcccgctattggcaggcatttcgtcagtacccgcgcttacagggc
gggtttatttgggactgggtagaccaaagtctgactcatcataatgaccatggtcagcct
tattgggcgtatgggggtgattttggtgatacccccaatgaccgccagttctgcatgaac
ggattagtcttccctgaccgcagcccgcacccgagcctttatgaagcgcagtgcgcacag
caattcttccaattttcgttgctgagtacgaccccgttggtgatcaacattaccagtgaa
tatttgttccgagagagtgataacgaacaattatattggcggataatgttagagggagaa
tccatgttggagggtagccaacccctgaatttgtcgcctgaaagctcacagtgctacagg
ttggcagagaaattacccacgcttaataaacctgggcagctatggctaaatgttgagata
aggcaaccaaaagaaaccccgtggtcccctgctcaacatcgcagtgcctggcatcaatgg
cgcttaccacaaccactcttttcgccgtccagtgatctgaccaatgctacagcgcattat
gcccctcaactgcaacataaccttcaactacaacataaccgtcaactacaacatgacctt
caactgcagcaagatgaacagcatattaaggtgacttatcagcaacaatgctggcaattc
agtcgtcaaacggggcggttggcgcaatggtgggtggcggataaaccgatgctactgcgc
ccactacaagatcaatttgtgcgtgcgccgctggataacgatatcggtatcagcgaagct
acgcatattgaccccaatgcttgggttgagcgctggaagaaagccggaatgtatcaactc
cagcaacgctgcctctctctacacgtagatcatttatcccattcagtacaaatcagtgcc
gaatacggttatgaattcgagcaagagcccttgctacacagccattgggtataccgtttt
gaccgacatggccgtatgaccattgatgttaacgtccgtatcgctacctcactccctgcg
ccagccagaattggcatgtgttgccaactggctgatatctcacctacggttgactggcta
gggttggggccacatgaaaactaccctgatcggcagcttgcagcacaatatgggcactgg
tccctgccattagagcagatgcacaccgcgtatattttccccagtgagaatggcttgcgc
tgcaatacccatacgctgaattatggccgctggacgttaacgggcgatttccactttggt
ataagtcgctacagcacccagcaactgatggtgacctcccatcaacatctattggaaccc
gaagagggcacctggctcaatattgatggcttccatatgggggtcggcggtgatgattca
tggagcccgagtgttcacattgatgacatactcacccgtgaaacctatcagtaccaaatc
tgttggcaatacaaggtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system