KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_1645Help
Entry
YpsIP31758_1645   CDS       T00570                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ypi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ypi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1915271..1916320
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIINSHPDMEMVAAAQDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKNSEITMRALELGAIDFVTKPQLGIREGMLAYS
ELIADKIRTAAKARLPQRVLENKPAMLSHTPLLSSEKLIAIGASTGGTEAIRAVLQPLPP
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGDRHLELARSG
ANYQVRIHDGPAVNRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGLLEMHRAGAY
TLAQNEASCVVFGMPREAIAMGGVNDVVELNQISQRMLAQISSGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtattgtgtgttgatgattctgcattaatgcgtcagctaatgact
gagattattaacagtcacccggatatggagatggttgctgcggcacaggatccgttggtt
gcccgtgatttgatcaaaaaatttaatccacaagttttgacgcttgacgtggaaatgcct
cgcatggatggcttggactttctcgagaaattgatgcgtctacggcccatgccggtggtg
atggtgtcttccctaacgggtaaaaactccgaaataaccatgcgggcgttggagttgggg
gcgattgattttgtcaccaaacctcagttagggatccgcgaaggaatgctggcttacagc
gaactgattgccgataagatccgcacggcggctaaggctcgtttaccacagcgcgtcctg
gaaaataaaccggcgatgctcagccataccccattgctcagcagtgaaaaattgatcgcc
attggggcatcaactggcggtactgaggcgattcgtgcggtattacagcctttgccacca
accagtccggcattgctgatcactcagcatatgccgccgggatttacccgttcgtttgct
gaacgcttgaataaactgtgccaaatcacggtaaaagaagcagaggatggcgagcgagta
ttaccgggacatgcctatattgcacccggtgatcggcacttggaactggcccggagtggt
gccaactaccaggtgcggatccatgacggacccgcggttaatcgtcaccgtccttcggtt
gatgttcttttccgttcggtggcgcagtatgccgggcgcaatgcggtcggggtgatcctc
acggggatgggcaatgatggggccgctggcttgctggagatgcaccgggcgggtgcctac
accctcgcacaaaatgaggccagctgcgtggtctttggtatgccacgtgaggcgattgcg
atggggggggttaatgacgtcgtggagttgaaccaaataagtcagcggatgttggcgcag
atcagtagtggtcaagcccttcgcatatag

DBGET integrated database retrieval system