KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_1721Help
Entry
YpsIP31758_1721   CDS       T00570                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YpsIP31758_1721 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YpsIP31758_1721 (btuE)
Enzymes [BR:ypi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YpsIP31758_1721 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1990420..1990974
Genome map
AA seq 184 aa AA seqDB search
MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEV
LGFPSNEFAGQEPGSDEEIHAFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVK
PEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLARFAPDMAPEAPILINAINQA
LASH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacccaatttacgccatttcagtgcaaacgattgatcaccagctggttaagttg
gcgaagtataaaggttccgttttattagtggtgaatgtggcttcgcaatgtggtttgact
cagcaatatgaaggattagaaagcctctataaaacctatcagaagcaaggttttgaggtt
ttaggtttcccgagtaatgagtttgcaggacaagagcctggcagtgatgaggaaattcat
gctttctgccgtggtacttttggtgtcgacttccccatgttcagtaaaattgaagtcaat
ggtccacatcggcatcctctatatcagcacttggttactgctaagcctgttgcagtgaaa
ccggaaggaagtgaattttatcaacgcctggcgagtaaaggccgtgagccaaaacagccg
ggtgatatcctatggaattttgagaaattcttgattagccgtgatggcactgtcttggcg
cgttttgctccagatatggcaccagaagcacctattttaatcaatgccatcaatcaggca
ctggctagccactaa

DBGET integrated database retrieval system