KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_1835Help
Entry
YpsIP31758_1835   CDS       T00570                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YpsIP31758_1835
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    YpsIP31758_1835
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YpsIP31758_1835
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     YpsIP31758_1835
Exosome [BR:ypi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YpsIP31758_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2122833..2124278
Genome map
AA seq 481 aa AA seqDB search
MNRVPTLSGIALSSGIALSTLLLSSALLTPNAIAAATGLYDRAAHGDVTQFGGARRLTED
QTQALRDSLSNKTVKNVILLIGDGMGDSEITSARNYAMGAGGFFKGIDALPLTGQYTHYA
LDKKTQKPNYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVST
AELQDATPAAQFAHVTGRKCYGPEETSEKCSTNALEKGGRGSITEQMIEGRADVTLGGGA
ASFSQVAKAGEWKDQSLRDQALARGYVIVENLDDLNAIKHANQQKPLLGLFSPGNMPVRW
QGPKASYHGNLDKPPVVCENNAERTSDIPTLAVMTEKAIDLLKTNENGFFLQVEGASIDK
QDHSANPCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEPEAKAPGLTQ
ALTTKDGAVMAISYGNSEDDSQGHTGSQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMAL
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgtacctactttatccggcatagcattatcatccggcatagcattatcgact
ctgctactgtccagtgcgctattaacgcctaatgcgattgcggctgctacgggcttatat
gaccgtgctgcgcatggtgatgtgactcaatttggcggcgcacgtcgtttgactgaagac
caaacccaggctctgcgtgactcgttatccaataaaacagtaaaaaatgtcattttgttg
attggagatgggatgggtgattctgaaatcacgtctgcccgtaactatgcgatgggggcc
ggtggtttctttaaaggcattgatgcgctgccgctgaccgggcaatacacgcactatgca
ctcgataaaaaaacacaaaaaccaaattatgtgactgattctgctgcatcagcgacggcc
tggtcatctggcgtaaaaacgtataatggtgcgttgggggttgatgtttttggtaaagac
catgttacgttgctggaactggccaaaaaagcaggcaaagcgacgggtaatgtctctacc
gctgaactacaagatgccactcctgctgcgcagtttgcccacgtgaccgggcgtaagtgc
tatggcccggaagaaaccagtgagaaatgcagtaccaatgcattggaaaaagggggccgt
ggctctattactgagcagatgattgaagggcgcgctgatgtcacgcttggcggtggtgca
gcatcattcagccaggtcgctaaagccggtgagtggaaagaccagtcgttgcgtgatcag
gcgttggcccgcggctacgtcattgttgagaaccttgatgacctgaatgcaataaaacac
gctaatcaacagaaacctctattgggtttattctcgccaggtaatatgccagtgcgttgg
caggggccaaaagcctcttatcatggcaatctggataaaccgccagtggtgtgtgaaaac
aatgctgagcggaccagcgacattccaacgttggctgtcatgacagaaaaagccattgac
ctgctgaaaaccaatgagaatggcttcttcttgcaagttgaaggggcgtcgattgataaa
caggatcactccgctaacccatgtggtcagtttggtgaaacggttgatctggatgaagcg
gtacaaaaagcgctggaattcgcccgtgctgatggcaacactttggtgattgtgacggct
gaccatgctcactccagccaaattatcgagcctgaagcgaaggctccgggcctgactcag
gcattaacgaccaaagatggcgcggtcatggcgatcagctacggtaactctgaagacgat
tctcaaggccatactgggtcacaattgcggatagcggcttatggtcctcacgcggctaac
gtcgtaggtttaactgaccaaactgatttgttcttcaccatgcgggatgcgatggcactt
aaataa

DBGET integrated database retrieval system