KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_1936Help
Entry
YpsIP31758_1936   CDS       T00570                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00260  Glycine, serine and threonine metabolism
ypi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypi01100  Metabolic pathways
ypi01110  Biosynthesis of secondary metabolites
ypi01130  Biosynthesis of antibiotics
ypi01230  Biosynthesis of amino acids
Module
ypi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YpsIP31758_1936 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YpsIP31758_1936 (trpB)
Enzymes [BR:ypi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YpsIP31758_1936 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABS48658
UniProt: A7FI33
Position
2240774..2241964
Genome map
AA seq 396 aa AA seqDB search
MTTLNPYFGEFGGMYVPQILVPALKQLEDAFVSAQLDPEFQAAFQDLLKNYAGRPTALTL
CQNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGTY
ETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEGRLPDAVLACVGGGSNAIGMF
ADFIDEPDVGLIGVEPAGLGIETGQHGAPLKHGKVGIYFGMKSPMMQTSDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALDAFKTLSCKEGIIPALESSHALAHALKM
IKADPDKEQILVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacttaatccctattttggcgaatttggcggtatgtatgtaccccaaatttta
gtgccagccctgaagcaactggaagacgcattcgtcagtgctcaactggatcctgaattt
caggccgcatttcaagatttgttaaaaaactatgccgggcgccctactgccctgaccttg
tgtcaaaatctgaccaaagggacaaagaccaagctatatctgaaacgcgaagatctgctg
cacggcggtgcacacaaaaccaatcaggttttaggtcaggctttattagctaaacgcatg
ggtaagaccgaaattattgccgaaaccggtgccggccagcacggggttgcctccgcactg
gcgtgtgcattgctgggtttaaaatgccgcatttatatgggggcgaaagatattgaacgt
cagtcgccgaacgttttccgtatgcgcctgatgggagccgaggttattccagtgcatagt
ggttcatcgacgctgaaagatgcctgtaatgaagcgctacgtgactggtcaggtacttat
gaaaccgctcactatatgctgggtaccgccgctggccctcacccttacccgacaattgtg
cgcgaattccaacgcatgatcggtgaagaaaccaaggctcagatactggaaaaagaaggc
cgcctgcccgatgcagtattggcctgtgttggtggcggttctaatgctatcggtatgttt
gctgattttattgatgagcctgatgtgggtctgattggcgtagagcctgccggcttgggg
atcgaaaccgggcaacatggtgcccccctaaaacacggtaaagtcggtatctacttcggt
atgaaatcaccgatgatgcagaccagcgatgggcaaattgaagaatcttactctatttct
gccggtctggacttcccctcggtggggccgcaacatgcttatttgaacagtattgggcgg
gctgattatgtctccattaccgatgatgaggctttagacgcatttaagacattgtcatgt
aaagaagggattattccagcgctagagtcctctcatgctctggcacatgcgttgaaaatg
attaaagcggatccggataaagaacaaatactggtggtgaatctctccggccggggtgac
aaagatattttcaccgttcacgatattctgaaagcacggggagagatttaa

DBGET integrated database retrieval system