KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_2143Help
Entry
YpsIP31758_2143   CDS       T00570                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00220  Arginine biosynthesis
ypi00250  Alanine, aspartate and glutamate metabolism
ypi00471  D-Glutamine and D-glutamate metabolism
ypi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YpsIP31758_2143
   00220 Arginine biosynthesis
    YpsIP31758_2143
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    YpsIP31758_2143
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     YpsIP31758_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ABS49489
UniProt: A0A0U1R2I8
Position
complement(2465900..2466907)
Genome map
AA seq 335 aa AA seqDB search
MPTDDSNNGIIDYVSTGHLPDPETVVKLVQEAHKRFSTDTAGVVSNVYPALERIPADLFG
ICMVGTNGKIHSAGDVDYEFTIMSVSKPFVFALVCQAIGAKTAREKLGVNSTGMAFNSVT
AIERASDGRTNPMVNSGAIATTSLVPGATSDEQWKFIYDGLCRFAGRELTLNEEVYQSAC
ETNFRNRGIANVLQGYGRLGCDPIIATDLYTRQCSLNVSARDLAVMGATLADGGVNPLTR
ERVVDNDICHYALAVMVTAGLYETSGDWLYDIGLPGKSGIGGGIVTVSPGKGGLGTFAPL
LDSAGNSIKGQLAARFLSRSLGMDMFVSEPYTEKN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccgacagatgatagcaataacggaattatcgactacgtatcaacaggtcatctacct
gacccggaaacagtcgttaaattagtgcaagaagcccataagcgatttagtacggatact
gctggtgtggtttctaatgtttatccggcattagagagaattcctgctgatctctttggc
atttgcatggttggcactaacggcaaaatccactctgctggcgatgtggattatgaattt
accattatgagtgtttccaaacccttcgtttttgcactggtttgtcaggctattggggcg
aagaccgcccgtgaaaaactcggggttaacagtaccggtatggcgtttaactcggtaacg
gccattgagcgggcatcggatggccgtacaaatccaatggttaactcgggtgcgattgcg
acgaccagtctggttcctggcgcgaccagtgatgaacaatggaaattcatttatgacggt
ttgtgccgctttgctggccgcgaattaacactgaatgaagaagtataccaatcggcttgt
gaaaccaatttccgtaatcgcggtatcgctaatgtgctgcaaggttatgggcgtctgggg
tgtgatcctattatcgccactgatctctatacccgccagtgttcactgaatgtcagtgcc
cgagatctggctgtgatgggcgcgacattagcggacggcggcgttaacccactgactcgt
gagcgagtggtggacaatgatatctgccattatgcattagccgtcatggtaacggcaggg
ctgtatgagacctctggagactggctctacgatattggcctgcccggtaaaagcggcatt
ggcggtggaattgtgacagtgtcacctggcaagggagggttggggacgttcgcaccgtta
ctcgacagtgcgggtaacagtatcaaagggcaacttgctgctcggttcttatcacgcagt
ctcgggatggatatgttcgtttctgagccttacaccgaaaagaattga

DBGET integrated database retrieval system