KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_2143Help
Entry
YpsIP31758_2143   CDS       T00570                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YpsIP31758_2143
   00330 Arginine and proline metabolism
    YpsIP31758_2143
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    YpsIP31758_2143
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     YpsIP31758_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2465900..2466907)
Genome map
AA seq 335 aa AA seqDB search
MPTDDSNNGIIDYVSTGHLPDPETVVKLVQEAHKRFSTDTAGVVSNVYPALERIPADLFG
ICMVGTNGKIHSAGDVDYEFTIMSVSKPFVFALVCQAIGAKTAREKLGVNSTGMAFNSVT
AIERASDGRTNPMVNSGAIATTSLVPGATSDEQWKFIYDGLCRFAGRELTLNEEVYQSAC
ETNFRNRGIANVLQGYGRLGCDPIIATDLYTRQCSLNVSARDLAVMGATLADGGVNPLTR
ERVVDNDICHYALAVMVTAGLYETSGDWLYDIGLPGKSGIGGGIVTVSPGKGGLGTFAPL
LDSAGNSIKGQLAARFLSRSLGMDMFVSEPYTEKN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccgacagatgatagcaataacggaattatcgactacgtatcaacaggtcatctacct
gacccggaaacagtcgttaaattagtgcaagaagcccataagcgatttagtacggatact
gctggtgtggtttctaatgtttatccggcattagagagaattcctgctgatctctttggc
atttgcatggttggcactaacggcaaaatccactctgctggcgatgtggattatgaattt
accattatgagtgtttccaaacccttcgtttttgcactggtttgtcaggctattggggcg
aagaccgcccgtgaaaaactcggggttaacagtaccggtatggcgtttaactcggtaacg
gccattgagcgggcatcggatggccgtacaaatccaatggttaactcgggtgcgattgcg
acgaccagtctggttcctggcgcgaccagtgatgaacaatggaaattcatttatgacggt
ttgtgccgctttgctggccgcgaattaacactgaatgaagaagtataccaatcggcttgt
gaaaccaatttccgtaatcgcggtatcgctaatgtgctgcaaggttatgggcgtctgggg
tgtgatcctattatcgccactgatctctatacccgccagtgttcactgaatgtcagtgcc
cgagatctggctgtgatgggcgcgacattagcggacggcggcgttaacccactgactcgt
gagcgagtggtggacaatgatatctgccattatgcattagccgtcatggtaacggcaggg
ctgtatgagacctctggagactggctctacgatattggcctgcccggtaaaagcggcatt
ggcggtggaattgtgacagtgtcacctggcaagggagggttggggacgttcgcaccgtta
ctcgacagtgcgggtaacagtatcaaagggcaacttgctgctcggttcttatcacgcagt
ctcgggatggatatgttcgtttctgagccttacaccgaaaagaattga

DBGET integrated database retrieval system