KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_2236Help
Entry
YpsIP31758_2236   CDS       T00570                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2545238..2545651)
Genome map
AA seq 137 aa AA seqDB search
MASTKTKISAAVLGLVIAGVPASIILSQFLDEKEGNRLTAYLDGKNIWTICRGVTRVDGK
PVMKGMRLTAEKCSEVNKLEADNALAWVITFNPPPVYEFAVYLSDNYPSNEELEQIANLR
QEMRDEGVDEDKLPISL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgactaaaactaaaattagcgccgctgttcttggtcttgttatcgcgggtgtt
ccagcatcaatcattcttagccagtttctggatgaaaaagaaggcaacaggctgacggct
tatctggacggaaagaatatctggactatttgccgtggcgtcacgcgagttgatggtaag
ccggtaatgaaaggaatgaggctgacagcagagaagtgtagtgaggtgaataaactggaa
gctgataatgcactagcgtgggtaatcacgttcaatcctcctcctgtctacgagtttgct
gtgtatctgtctgacaattatccttccaatgaagaattggaacaaatcgctaatttaaga
caagaaatgcgcgatgagggagttgatgaagataagctccccatctcactgtaa

DBGET integrated database retrieval system