KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_2395Help
Entry
YpsIP31758_2395   CDS       T00570                                 

Gene name
agaN
Definition
alpha-galactosidase AgaN (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ypi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ypi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ypi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2696229..2698355
Genome map
AA seq 708 aa AA seqDB search
MNTTFVRLSSRSSDMIVRCSPYAEIVYWGKPLLDYSPAMMEALNRPVANSRLDSDIPLTL
CPENGRGLFSVPGMEGNRDGEDWSPIFTSQSHTLENNLLTIISEDTSAGLRLVSELQMCP
DSGVIKTRNTLTNIKAGCYRIDRLAVTLPFPERANEIMAFNGRWIKEFQRHSLKLDHGGY
IQENRRGRTSHEYFPGIVVGKAGFSEQQGEVWGLHLAWSGNHRLRADCKSDGRRQVQAEA
LYFSGEIVLEHLQSVSTPWVYATYSATGLNGMSHSFHHYVRQNIVPSLAEKPRPVHLNTW
EGIYFKHDPDYIIQMVKNAAKIGVERFIIDDGWFKGRNNDLSSLGDWYIDAEKYPQGLNP
IIEAVNEYGMEFGIWVEPEMINQDSDLYRNHPDWVLKLDGYPLLKGRDQLLLDLSNPAVF
DYLLERLSWLLGEHKVDYVKWDFNREMVQPGHRGHPSLVQQTEQLYRLFDQLNLHFPHIE
FESCASGGGRIDYEILQRCHRFWPSDSNDALDRQQIQRGMSYFFPPEVMGAHIGGTPCHT
TARMHSINFRGLTALFGHMGVELDPVSESPAEQQAFARYIALHKQLRPLLHSGNTIRLDH
PDKTTLINAVIAHDQQQAVVLISQLALPEYALCGNVLIPGLNPSTHYQIEVLDMPDSMHK
PRNNTMKRYPAWLKSPLIVSGDWLEKAGIALPILNPESAILIQLSAVN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaatactacctttgtcagattatccagccgttcttctgacatgatcgtgcgctgctct
ccctacgcagaaattgtttactggggtaagcctctgcttgattactcgcctgcgatgatg
gaagccttaaaccgcccggtcgctaacagccgcctggacagcgatataccgttgacgctc
tgccctgaaaatggccgagggctgttcagcgtgcccggtatggagggaaaccgtgatggc
gaagattggtctcccattttcaccagccagagccatacacttgaaaacaatttattaacg
attattagcgaagatacgagcgcgggcttgcggctggtgagtgagttgcagatgtgccca
gacagtggcgtgataaaaacccgcaatacgctgaccaatattaaagccggatgctaccga
atcgatcggttggccgtgaccttgccttttccggaacgtgccaatgaaatcatggccttc
aatggccgttggattaaagagttccagcgccactcacttaaactcgatcatggcggttat
attcaggaaaatcggcgcggcagaacctcacatgaatattttcccggcatagtagtaggg
aaagcaggcttcagtgagcaacagggcgaggtctggggcttgcatctggcctggagtgga
aaccatcgtttacgcgctgactgtaaaagtgatggccgccgtcaggtgcaggccgaagcc
ctctatttttccggtgaaatcgttctggaacacttacagagtgtcagtaccccgtgggtc
tacgcgacctattccgctaccgggttgaacggtatgagccacagttttcatcactatgtg
cgccagaatatcgtgccatcactggcagaaaaaccgcgcccggtgcacctcaatacctgg
gaaggcatctattttaagcatgacccagactacattattcagatggtgaaaaacgcggcc
aaaattggtgtggagcgctttatcattgatgatggctggttcaaaggacgcaacaacgat
ttaagttcactgggcgattggtatattgatgccgaaaaatacccacaggggctgaacccc
attattgaagcagtgaatgaatacggtatggagtttggtatctgggtggaacctgaaatg
atcaatcaggattctgatttataccgtaatcatcctgactgggtgctgaaacttgacggc
tacccgctactgaaaggacgcgaccaactgttgctcgatttgtcgaacccggccgttttc
gactacctgctagaacgcttgagctggttattgggcgaacacaaagttgactatgttaaa
tgggatttcaaccgcgagatggtccagcccggtcatcgcggccacccttcgttggtacaa
cagaccgagcaactgtatcgcttattcgaccaactcaacctgcatttcccacatattgaa
tttgaatcctgcgcgtcaggcggggggcgtattgattatgaaattctgcaacgctgccac
cgtttctggccatcagacagcaatgacgctcttgatcgccagcagatccagcgagggatg
agctacttcttccctccagaagttatgggcgcgcatattggcggtactccgtgccatacc
accgccagaatgcactctattaattttcgggggctgacagcgctgttcggccatatgggg
gtcgagcttgatccggtgagtgaatctcctgccgagcaacaggcttttgcccgttatatt
gcgctacataaacaactgcggccgctgttacatagcggaaacacgatccggctcgaccat
ccggataaaacaacattaattaatgccgttatcgcacacgaccagcagcaagctgtcgtc
ctgatcagccagctagcactaccggaatatgccttatgtggcaacgtattgattcctggt
cttaacccatccacacactatcagatcgaggttctggacatgcctgacagcatgcacaaa
ccacgaaataacaccatgaagcgctatccagcctggttgaaaagcccgctcatcgtcagt
ggcgattggctagagaaagcaggaattgcccttcccatcctcaatcctgaatcggctatc
ctgatacagctttcagccgtaaattaa

DBGET integrated database retrieval system