KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_2437Help
Entry
YpsIP31758_2437   CDS       T00570                                 

Definition
(GenBank) putative UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00040  Pentose and glucuronate interconversions
ypi00052  Galactose metabolism
ypi00500  Starch and sucrose metabolism
ypi00520  Amino sugar and nucleotide sugar metabolism
ypi01100  Metabolic pathways
ypi01130  Biosynthesis of antibiotics
Module
ypi_M00362  Nucleotide sugar biosynthesis, prokaryotes
ypi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YpsIP31758_2437
   00052 Galactose metabolism
    YpsIP31758_2437
   00500 Starch and sucrose metabolism
    YpsIP31758_2437
   00520 Amino sugar and nucleotide sugar metabolism
    YpsIP31758_2437
Enzymes [BR:ypi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YpsIP31758_2437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABS48316
UniProt: A0A0U1QZS3
Position
complement(2746186..2747079)
Genome map
AA seq 297 aa AA seqDB search
MTKLKAVIPVAGLGMRMLPATKAIPKEMLPIVDKPLIQYVVNECVAAGINEIILITHSSK
NAVENHFDTSYELEAMLEARVKRQLLDEVQSICPPGVTIMHIRQGHPEGLGHAVLCAKPL
VGDSPFVVLLPDVLIDDEQSDLTRDNLAQLVQRFEETGVSQVLVHSVDPETLSNYSVVSC
EKSTLLPGESSRINAMIEKPQSSADLQSNLSAVGRYVLSAHIWPLLEQTKPGAWGRIQLT
DAIDALAAVEAVDAVALTGKSYNCGEKLGYMQAYVAYGLRHPQQGAEFKAWLKDFVA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattgaaagcagtcatccctgtcgctggtttaggcatgagaatgctcccggcg
accaaagctattccgaaagagatgttgccaatcgttgataagccactgatccagtatgtg
gtgaatgaatgtgttgctgcgggcatcaacgaaattattctgataacccattcatccaag
aacgccgtagaaaaccattttgatacttcctatgaattggaagcgatgctggaggcccgt
gttaagcgccagctattggatgaagtgcagtcaatttgcccaccgggtgtgacaataatg
catattcgtcaggggcatccagaggggttgggccacgcggttttatgtgccaaaccgtta
gtgggggattcgccatttgttgtcttgctgccagatgttctaattgatgatgagcaatct
gatttaacccgcgataatctggctcaattagtgcaacgttttgaagagaccggggtcagt
caagttttggttcattcggtagatcctgaaacgctgtctaattattcggtggtttcctgt
gagaaatcgaccttgttgccaggagagagcagtcggattaatgccatgatcgagaagcca
caaagctcggcagatttacaatcaaatctgtctgcggtggggcgctatgtactgtcagcg
catatttggccattgttggaacagactaaacccggcgcttgggggcgtatccaactgacc
gatgctattgatgctttggctgcggtggaggcggttgatgcggttgccttaaccggtaag
tcctataactgcggtgagaaactcggctatatgcaggcttatgtggcttatggtttgcgt
cacccacagcaaggtgctgagtttaaggcatggctaaaggatttcgttgcgtaa

DBGET integrated database retrieval system