KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_2470Help
Entry
YpsIP31758_2470   CDS       T00570                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2790076..2790738)
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAELVHQALLARGLETPLRKPELDAETRKTRIQAHMTEVMHLLNLDLTDDSLAD
TPRRIAKMYVDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgagttggttcatcaagcgctgctggcccgtggtctt
gaaacccctttacgtaaaccagaattagatgccgagacgcgcaaaactcggattcaggcc
catatgacagaagtcatgcatttgctgaatcttgatttaaccgacgatagtctggctgat
acaccaagacgcattgcgaagatgtatgttgatgagattttctccggattggattacgaa
aatttccctaaaatcacactgattcaaaataaaatgaaagttgatgaaatggtaacggta
cgggatatcactctgaccagcacctgcgaacatcattttgtgacgattgatgggaaagcc
accgtcgcttatattccgaaagacagtgtcattggtttgtcgaaaatcaaccgtatcgtg
cagttttttgcgcagcgtccgcaagtgcaggaacgattaacacagcagatcttgctcgca
ttacaaaccctgttgggtaccaataatgtcgcagtttctattgatgcagttcattattgc
gttaaagcacgtggtatccgtgatgcgaccagcgcgacgaccaccacatcattaggcggg
ttatttaaatccagtcagaatacgcgtcaggaatttctgcgtgcggttcgtcaccacggc
tga

DBGET integrated database retrieval system