KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_2480Help
Entry
YpsIP31758_2480   CDS       T00570                                 

Gene name
moeA
Definition
molybdopterin biosynthesis protein MoeA
Orthology
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Brite
Enzymes [BR:ypi01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     YpsIP31758_2480 (moeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2802058..2803332
Genome map
AA seq 424 aa AA seqDB search
MDHCNTSDLLSLEQALTKMLSQATPLPATEVIPLSEAAGRITASAITSPIAVPPFANSAM
DGYAVRWHELSDEIPLPVAGVAFAGAPFKDVWPEKTCIRIMTGAPLPKGADAVVMQEHAV
VSEQGVIFNSNIRIGQNIRLAGEDIQQGASVFPAGVKLGAAQLPLLASLGIAEIAVYRAL
KVAIFSTGDELQPIGQPLAEGQIYDTNRFAVRLMLQQLGCQIIDLGVIRDDQHALRAAFQ
QADTAADLVISSGGVSVGEADYTKQILDELGDIGFWKLAIKPGKPFAFGKLSNAWFCGLP
GNPVSAALTFYQLVQPLLAKLSGHTEWHPPLRLKAKATTPLKKTPGRLDFQRGIFSSNAD
GQLEVRTTGHQGSHIFSSFSQGNCFIVLERERGSVAVGESVEIELFNELLGGNRPFAIHH
PVGG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggatcactgtaatacctcggatttactctctctggaacaagcactgaccaaaatgcta
tcacaggccacaccattgccagcaacagaggtcatcccattgtctgaggctgcgggccgc
atcaccgccagcgccattacttcacctattgctgtcccacctttcgccaactcagcgatg
gacggctatgcggtacgttggcatgaattgagcgacgagatacccttacccgtcgcagga
gtagcgtttgcaggtgcgccgtttaaagatgtgtggccggaaaagacctgcattcgcatt
atgacaggtgcgccactccccaagggtgcagatgccgttgtcatgcaagagcacgctgtc
gtgagtgaacaaggtgtcatcttcaatagtaacattcgaatcgggcaaaacattcggctg
gcgggtgaagatatccagcaaggagcgtcagtttttccggctggcgttaaattaggtgca
gcacagctaccgctattagcctcgttaggtattgctgaaatcgcggtttatcgtgcatta
aaagtggctattttctcaaccggtgatgaattacagcctatcggacagcccttagctgaa
ggacagatttacgatactaaccgctttgccgtcaggctaatgttgcagcaattggggtgt
caaatcatcgatcttggtgttatccgtgacgatcaacatgcactacgtgcagcatttcag
caggcggatactgcagcagacttggtcatcagcagtgggggcgtttcagtcggtgaagcc
gattataccaaacagatactggacgaactcggggatattggtttttggaaattagccata
aagcccggtaaaccttttgcttttggtaaacttagcaatgcctggttctgcggtttacca
gggaatcctgtctctgcggccctaacattctatcaactggtacaaccgctgttggcaaag
ctgtccgggcatacagaatggcatccaccactgcgattaaaagccaaagcgacaacacca
ctgaaaaaaacaccaggccgcttggactttcaacgtgggattttttccagcaatgcggac
ggtcagttagaggttcgcacgactggccaccaaggctcccacattttcagttcattcagt
caaggcaactgttttatcgtgcttgaacgggaacgtggttcggtagccgtgggggaatcc
gtagaaatagagttgtttaatgaattgttaggaggtaatcgaccgtttgccattcatcac
cctgtcggaggttga

DBGET integrated database retrieval system