KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_2729Help
Entry
YpsIP31758_2729   CDS       T00570                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YpsIP31758_2729
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     YpsIP31758_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3083006..3084442)
Genome map
AA seq 478 aa AA seqDB search
MSYQQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGSHGVDRVMTDGVLEGYRYP
NHEAVDFYSHYKEDIALFAEMGFKCFRTSIAWTRIFPHGDEQQPNEAGLQFYDDMFDELL
KYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSEVVMERYKSKVKYWMTFNEIN
NQRNWKYPLFGYCCSGVVFTEQENPEETLYQVLHHQFVASAKVVKLGHAINPEFKIGCMV
AMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYILQEWARRGFNIHMEEGDLE
TLRDGCADYMGLSYYMSNAVSAINPGSGNSLSGFEGSVPNPHVKASDWGWQIDPVGLRYS
LSVLYERYQKPLFIVENGFGAIDKVAADGMVHDDYRIAYLKAHIEQMKKAVFEDGVDLMG
YTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMARSRKLSFDWYKKVIASNGEVL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcaacagttaccgaaagattttttatggggtggcgcggttgcggcacatcag
gttgaaggcggctgggataaaggcggcaaaggcgtgagcattgctgatgtcctctctggt
ggctcccatggggttgaccgtgtgatgaccgacggagtactggaagggtatcgttatcca
aaccatgaagcagttgatttttatagccattacaaagaagacatcgcgctgtttgccgaa
atgggcttcaaatgtttccgcacctcaattgcctggacacgtatcttcccgcatggcgat
gaacagcaacccaatgaagctggcctgcaattttatgacgatatgttcgatgaattgctg
aaatacggtattgaaccggtgattacgttatctcacttcgaaatgccgtggcatctggtc
aaagaatatggtggctggaagaaccgtaaagtggtcgatttctttgtaaaattcagtgaa
gtcgtcatggagcgctacaaaagcaaagttaaatattggatgaccttcaacgagataaat
aaccagcgtaactggaaatatccgctgtttggttattgctgttctggtgtggtgttcact
gaacaagagaacccagaagaaaccctgtatcaggtactgcatcatcagtttgttgccagt
gccaaagtggtcaagctgggtcatgccattaatccggaatttaagattggctgtatggtg
gcgatggtgcctctgtatcctttctcctgccatccagatgacatgatgtattccgttgaa
gctatgcgtgagcgctatcttttcggcgacgttcatatgcgcggttattacccttcatat
attttacaagagtgggcgcgccgtggtttcaatatccatatggaagagggggacctcgag
actctgcgtgatggttgcgccgattacatggggctgagttattacatgagtaacgcggtc
tctgcgattaatccaggtagcggcaattcactctctggttttgagggcagcgtgccgaac
ccacacgtcaaagcctctgactgggggtggcagattgatccggtgggtctgcgttactct
ctgagtgtgttgtatgaacgctatcagaagccgctatttattgttgaaaatggttttggt
gcgatagataaagttgcagcggatggcatggtgcacgacgactaccgcattgcttatcta
aaagcccatatcgagcagatgaaaaaagcggtatttgaagatggcgtggatctaatgggt
tataccccatggggatgtattgactgcgtatctttcactaccggtgaatacagcaaacgt
tatggctttatttatgtcgataaaaacgatgatggcaccggtacaatggcgcgttcacgt
aagttaagttttgattggtataaaaaagttattgccagcaatggtgaagttctttaa

DBGET integrated database retrieval system