KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_2880Help
Entry
YpsIP31758_2880   CDS       T00570                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YpsIP31758_2880 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YpsIP31758_2880 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    YpsIP31758_2880 (sucB)
Enzymes [BR:ypi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YpsIP31758_2880 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3248858..3250081)
Genome map
AA seq 407 aa AA seqDB search
MSSVDINVPDLPESVADGSVATWHKKPGDSVKRDEVLVEIETDKVILEVPASQDGILDAI
LEDEGATVTSRQVLGRIRPSDSSGKPTEEKSQSTESTPAQRQTASLEEESNETLSPAIRR
LIAEHDLDATAIKGSGVGGRITREDVDSHLASRKSASAVVADAKAVAAAAPVLAGRSEKR
VPMSRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEAFEKRHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTLSMADIEKK
IKELAVKGRDGKLKVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVILPMMYLALSYDHRLIDGRESVGYLVTVKEMLEDPARLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattaatgttcctgacctccctgagtctgtagccgatggctctgta
gcaacctggcacaaaaaaccaggcgacagcgtcaaacgtgatgaagtgctggttgagatt
gaaacggataaagtgattttggaagtgccagccagtcaggacggtattttggatgccatt
ctggaagatgaaggtgccacagtgacgtcacgtcaggtgctggggcgcattcgtccaagt
gatagttctggtaaaccgactgaagaaaaaagtcagagtacggagtcaactccggctcaa
cgccaaacagccagcttggaagaagaaagtaatgaaaccctcagtccggctattcgccgc
ctgattgctgagcatgatctcgatgcaacggcaatcaaaggcagcggtgttggtggccgt
atcacccgtgaagacgttgatagccatttagcgagccgtaaatcggcctctgcagtggta
gctgacgctaaagcggtagccgctgctgcacctgtattggcggggcgtagtgagaaacgt
gtcccgatgagccgtctgcgtaaacgtgttgctgagcgtctgttagaagcgaaaaacagc
accgcaatgttgaccacgtttaacgaaattaatatgcagcccattatggacctgcgtaag
cagtacggtgaagctttcgagaaacgccacggtgtacgtctgggctttatgtccttctat
atcaaggcagtggttgaagcactgaaacgttatcctgaagtgaatgcttctattgatggc
gaagatgttgtctaccataactatttcgatgtcagtattgcggtttctactccacgtggt
ttggtaacgccagtattacgtgatgtagacacgttgagcatggctgatattgagaagaaa
ataaaagaattggctgtaaaaggtcgtgatggcaagctgaaagttgaagagttgactggc
ggtaactttaccattaccaatggtggcgtgtttggctcactgatgtcgacaccgatcatt
aacccaccacaaagcgcgatccttggcatgcatgccatcaaagatcgcccaatggcggta
aatggtcaggttgtgatcctgcctatgatgtatttggcactttcctacgatcaccgtttg
atcgatggccgcgagtctgttggctatctggtgacggtaaaagagatgctggaagatcct
gctcgcttgctacttgatgtataa

DBGET integrated database retrieval system