KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_2903Help
Entry
YpsIP31758_2903   CDS       T00570                                 

Gene name
chb
Definition
chitobiase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YpsIP31758_2903 (chb)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YpsIP31758_2903 (chb)
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YpsIP31758_2903 (chb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3270396..3273071)
Genome map
AA seq 891 aa AA seqDB search
MNKFKLNALAAITATFGLIGYANGSATNQQVVDQLSTLKVNYKLLDNRAADNGVDCAKLG
ADWASCNKVMITLTNTGDEIKGQDWAIYFHSIRMILAVDNDQFTVTHLTGDLHKIEPTAK
FAGFPANQTIEIPITGEYWQLFATDFMPRWYATSGDAKPKVLASTDTEDINAYLTPFTGD
QWKRTKDDNNVLMTPESRFVKNEAVKTLSAANLRGQIIPTPLDVKVYPQDADLSLGVALE
LSALPKPASDAIQQRFELLGLALSATGYPIKTVIQPTAFNGDHAVSGAYELKIGEKGAEV
IGFDQVGVFYGLQSILSLVPIEGSKTIATLDAKDAPRFDYRGVSLDVGRNFKTKAAVLRL
LDQMSAYKLNKFHFHLSDDEGWRIEIPGLPELTDVGSQRCHDLTETTCLLPQLGSGPESN
NLGSGYFTRADYIDILKYAKARQIDVIPEIDIPAHARAAVVSMEARYNNLMKQGKEKEAN
EFRLVDPTDDSNTTSVQFYERKSYLNPCLDSSKHFVDKVIGEMAQMHKEAGMPLTTWHFG
GDEAKNIRLGAGYQDKNGKIEPGKGIIDMRVEDKPWAKSQVCQDMVKQGKVQDIAHLSSY
FAIEVSKLVNAHGIEKMQAWQDGLRDAKDASAFATKRVGVNFWDTLYWGGADSVNDWANK
GYEVIASNPDYVYFDMPYEVNPSERGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGN
HFSAKSDKPWPGVQGISGQSWNETVRTDEQMEYMAFPRVLPLAERAWHRASWEQEYKAGR
EYKGGETQWVDTQALSTDWQRFANIMGQRELAKLDKAGVAYRLPVPGARVVAGQLEANIS
LPGLLIEYSTDGGKKWQQYDAKAQPTVSGEVMIRSTSPDGKRSSRAEPVNI
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttaagttaaatgcgttggcggccatcacagctacctttggtttgattggc
tacgcgaacggtagcgccaccaatcaacaagttgttgaccaactcagtaccttgaaagtt
aactataaattattggataaccgtgctgctgataatggcgttgattgcgccaaattgggt
gctgattgggcatcttgtaataaggtcatgataacgctgaccaacaccggggatgagatc
aaaggccaggactgggcgatttattttcacagtattcgtatgattttggctgtggataac
gatcagtttacggtgactcacctgacgggggatctgcacaaaattgaaccaaccgctaag
tttgctggtttccccgccaatcagacaattgaaatcccaattacgggggaatactggcaa
ttatttgccactgactttatgccgcgttggtatgcaacctcgggcgatgccaagccaaaa
gttttggccagtactgatacggaagacataaacgcatacctgacaccgtttactggtgac
cagtggaagcgtaccaaagacgataataatgtgctgatgacgccagaatcacgtttcgtc
aaaaacgaggcagtgaaaacactctctgcggctaacctgcgtgggcagattatcccaaca
ccactggacgttaaggtttatccgcaagatgccgatctgagcctcggtgtggcgctggaa
ttgagtgcgctacccaaaccggcctctgatgccatacagcaacgttttgaattgctgggc
ctggcgctaagcgcgacgggctatccgattaaaacagtgattcagccaacggccttcaac
ggggatcacgctgtttccggtgcgtatgaactgaaaattggtgagaagggcgcagaggtg
attggttttgatcaggtcggtgtattctatggcctgcaatctatcctttccttggtacct
attgaggggagcaaaacaatagccacccttgatgcgaaagatgcgccacgctttgactac
cgtggtgtctcgctcgatgtggggcgtaacttcaaaaccaaagcggcggtcctacgttta
ttggatcaaatgtcagcttacaaactgaataaattccacttccatctgagtgatgatgaa
ggctggcgcattgagatccctggcctgcctgaattgaccgatgtcggcagccagcgttgc
catgatttgactgaaaccacctgtttgctaccacagctaggctctggccctgagagcaat
aatctggggagcggttatttcactcgcgctgattacatcgatattctgaaatatgccaaa
gcgcgccagattgatgtcattcctgagatagatatcccggctcacgcccgtgctgctgtg
gtatcgatggaagcgcgttataacaatttgatgaaacagggtaaagagaaagaagccaat
gaattccgtctggttgatccgaccgatgactcgaataccacatcagtacagttctatgag
cgtaaaagttatctgaatccctgcctggactcttctaagcattttgtcgacaaagtcatt
ggtgaaatggcgcagatgcacaaagaggccggtatgccgctgaccacctggcatttcggg
ggcgatgaggcgaagaacatccgtctgggggcgggttatcaggataagaatggcaaaatt
gagccaggtaaaggcatcatcgatatgcgcgttgaagataaaccgtgggcgaaatctcag
gtttgtcaggacatggtcaagcaaggcaaagttcaagatattgctcatctttccagctac
ttcgccattgaagtcagcaaactggttaatgcgcacggtatcgaaaaaatgcaggcctgg
caggatggactgagagatgccaaagatgcgagcgcgtttgctaccaagcgtgttggcgtc
aacttctgggataccctctactggggcggagcggactccgtcaacgattgggccaataaa
ggttatgaagtcattgcctcgaatccagattatgtctacttcgatatgccgtatgaagtt
aacccaagtgaacgcggttactactgggcgacgcgctttagcgatgaagccaaggtgttc
agcttcgcacctgacaacatgccacagaacgccgaaacctcggttgatcgcgatggtaat
catttcagtgcgaagagtgataaaccctggccgggtgtacagggtatctccggtcagtct
tggaatgaaacggtacggactgatgagcagatggagtacatggccttccctcgtgtatta
ccgctggctgagcgtgcatggcatcgcgcatcctgggagcaggagtataaagcggggcgt
gaatataaaggtggcgagactcagtgggtcgatactcaggcattaagcacggattggcag
cgtttcgctaacattatggggcaacgtgaactggcaaaactggataaagcgggtgtggct
taccgcttgccagtaccgggggccagagtggtggcggggcagttggaagccaatatttcc
ttgccaggcctccttatcgagtactccactgatggaggcaaaaaatggcagcagtatgat
gctaaagcgcaacctactgtcagcggtgaagtgatgatccgttccaccagcccagacggt
aagcgcagtagccgtgcggagccagttaacatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system