KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_3021Help
Entry
YpsIP31758_3021   CDS       T00570                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YpsIP31758_3021
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YpsIP31758_3021
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YpsIP31758_3021
Lipid biosynthesis proteins [BR:ypi01004]
 Fatty acid synthase
  Component type
   YpsIP31758_3021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3400689..3401324
Genome map
AA seq 211 aa AA seqDB search
MNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQAT
PSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSEI
INQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEWM
QDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaacgttttccgctggcatcttcccttccttttactgttgggattattc
agtttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgccggt
taccgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagccacg
ccttcgttaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaagggcta
gcgcgcttacccgccctactcaagcaacatcagccacgctgggtgctgattgaactgggt
gccaatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaaatt
atcaatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattcccccc
aactatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaacag
ttcgacatccccctactccctttttttatggaacaggttgccgttaagccagagtggatg
caggatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatggcg
caacaactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system