KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_3180Help
Entry
YpsIP31758_3180   CDS       T00570                                 

Definition
ARD/ARD' family dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ypi00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3585008..3585550)
Genome map
AA seq 180 aa AA seqDB search
MSGLTIFSDQQPEKPLWQSHNAEEIQQQLTAIGVRFERWQADCELGENPQPEAVIAAYQH
EIDRLVAENGYKSWDVISMRPDNPQREALREKFLSEHTHGEDEVRFFVEGSGLFCLHLNE
KVYQILCEKNDLLSVPADIPHWFDMGSAPNFTAIRVFDNPEGWIARSTGDNIADGYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattaacgatttttagcgaccagcagccagaaaaaccgttgtggcagagccat
aatgctgaagaaattcaacagcagttgacggctatcggggtgcgctttgagcgctggcag
gcagattgtgaactgggtgagaacccacagccagaggccgttattgcggcttatcagcat
gagattgatcggctggtggcagaaaatggctataagagctgggatgtgatcagtatgcgc
cccgataatcctcaacgtgaagcactgcgagagaaatttttatctgagcatacccacggc
gaagatgaagtgcgtttttttgttgaaggtagcgggctgttctgtttgcatctaaacgag
aaggtttaccagattctgtgcgaaaaaaatgatctgttatccgtcccggcggatatccct
cattggttcgatatggggtcggcacccaatttcacggctatccgcgtgttcgataacccg
gaaggctggatagcacgttctaccggcgataatattgccgacggctatcctcgcctcgcc
taa

DBGET integrated database retrieval system