KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_3297Help
Entry
YpsIP31758_3297   CDS       T00570                                 

Gene name
truD
Definition
tRNA pseudouridine synthase D (EC:5.4.99.-)
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3708146..3709195)
Genome map
AA seq 349 aa AA seqDB search
MDMENLTWLHGKPTASGILKANPEDFVVVEDLGFEPDGEGEHLLVRIRKNGCNTQFVADY
LARFAKLHPRLVSYAGLKDRHAVTEQWFCLHLPGKEAPDLATFELEGCEVLEAVRHKRKL
RIGSLKGNAFTLVLRHITDRQDVEQRLQQIAAQGVPNYFGSQRFGRGGNNLVQARLWANN
EIRVKERSKRSFYLSASRSAMFNLISSHRLAQQLSTTVLEGDALQLSGRGSWFVAQADEL
ATLQQRVTAGELNITAPLPGDSELGTHGEALAFEQACLAEQTELLSLIKRERVEGSRRAV
LLKPQNMISNWWDDVTLELSFWLPAGSFATSVVREIMNQDRADDTDIIE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggatatggaaaacctgacctggctacacggtaaacctacggcgagcggtattttaaaa
gcgaatccggaagattttgttgtcgtagaggatttgggatttgaaccggatggggaaggt
gagcatctgctggttcgtattcgtaaaaatggctgcaatacccaattcgttgctgattat
ttggcgcgctttgccaaacttcatccgcggttggtgagttatgcggggttaaaagaccgc
catgcggtcaccgaacagtggttttgtttacacttgccaggaaaagaagcgccagatctg
gccacctttgagctggaagggtgtgaagtattggaagcggtgcggcataaaagaaaatta
cgcattggttcactgaaaggcaatgcgtttaccttagtactgcgccatattacggatcgc
caggatgtggaacaacgtttacagcaaatagccgcccagggcgtacccaactattttggt
agccagcggtttggccgtggtggtaataatctggtgcaggcccgtttatgggcgaataat
gaaattcgggtaaaagaacgcagcaaacgtagcttttatctgtcggccagtcgcagcgcg
atgttcaatctgattagcagtcaccgcttggcgcaacaactgtcgacgacggtactggag
ggtgatgcattacaattatccgggcgtgggagttggtttgttgctcaagcggatgaatta
gccacgttgcaacagcgcgttactgcgggtgaactgaatatcaccgcgcctttaccgggg
gacagtgaactgggtacccacggtgaagcattagcctttgaacaggcgtgtttggcagag
caaactgaattactgtcattgattaagcgtgagcgcgttgaaggtagccgccgggcagta
ctgctaaaaccgcagaatatgataagcaactggtgggatgatgtcactcttgagctgagt
ttctggctccctgcggggagctttgcgaccagtgtagtgagggaaataatgaaccaggat
cgggctgatgatacggatattattgagtaa

DBGET integrated database retrieval system