KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3362Help
Entry
YpsIP31758_3362   CDS       T00570                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00010  Glycolysis / Gluconeogenesis
ypi00020  Citrate cycle (TCA cycle)
ypi00620  Pyruvate metabolism
ypi01100  Metabolic pathways
ypi01110  Biosynthesis of secondary metabolites
ypi01120  Microbial metabolism in diverse environments
ypi01130  Biosynthesis of antibiotics
ypi01200  Carbon metabolism
Module
ypi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YpsIP31758_3362 (aceF)
   00020 Citrate cycle (TCA cycle)
    YpsIP31758_3362 (aceF)
   00620 Pyruvate metabolism
    YpsIP31758_3362 (aceF)
Enzymes [BR:ypi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YpsIP31758_3362 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ABS48270
UniProt: A0A0U1QZN0
Position
complement(3778297..3779877)
Genome map
AA seq 526 aa AA seqDB search
MSIEINVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVATGSLIMVFDATGAAAAPVKAEEKPAAPAQAAAPAASAAKNVEVPDIGDDEVEVT
EVMVKVGDKVDAEQSLITVEGDKASMEVPAPFAGIVKEIKISTGDKVKTGSLIMVFEVEG
AAPAPAAEAAPAQQAAPVAPAPAAAPAAKAESKGEFAENDAYVHATPVIRRLAREFGVNL
AKVKGTGRKGRILREDIQAYVKDAVKRAEAAPAAAGGGLPGMLPWPKVDFSKFGEIEEVE
LGRIQKISGANLSRNWVMIPHVTQFDEADITEVEAFRKQQNIEAEKKKQDLKITPLVFLM
KAAAKALEEFPRFNSSISEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGIVELSR
ELSVISKKARDGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVW
NGKEFAPRLMLPLSLSFDHRVIDGAAGARFAAYIATIMADIRRLVM
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagaaattaatgtaccagacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggcgataccgttgaagcggaacagtcgctaatcaccgttgaaggcgat
aaagcttccatggaagttccttcacctcaggcgggcgtggttaaagagatcaaaattgcg
gttggcgataaagtggctaccggttctctgatcatggtcttcgacgctacgggtgccgct
gcggcaccggttaaagcagaagaaaaaccggcggcgcctgctcaggcagcggctccggca
gcctctgcggcgaaaaatgttgaagtgccagatatcggtgatgacgaagttgaagtgact
gaagtgatggtgaaagtgggcgataaagttgacgccgaacaatcactgattacggttgaa
ggcgacaaagcgtcgatggaagtgcccgcaccgtttgctggtatcgtgaaagaaatcaaa
atcagtaccggcgacaaagtgaaaaccggctctctgattatggtcttcgaagttgaaggt
gcagcgccagcgccagcagcagaagcggctccggctcaacaagccgcacctgtcgcgcca
gcgccagccgccgcacctgccgccaaagcagaaagcaaaggcgagtttgccgagaatgac
gcttacgtgcatgccacgccggttatccgtcgtctggcgcgtgagttcggtgtgaacctg
gcgaaggtgaaagggacaggccgtaagggccgtatcctgcgcgaagacattcaagcttac
gtgaaagatgccgtgaaacgtgccgaagctgcaccagcagcggctggcggcggcctgccg
ggcatgttgccttggccaaaagttgatttcagtaaatttggtgaaatcgaagaagtcgaa
ttgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgggtcatgatccca
catgtgacgcaattcgatgaagcggatatcactgaagttgaagccttccgtaagcaacag
aacatcgaagctgagaagaaaaaacaagacctgaaaatcaccccgctggtgttcctgatg
aaggccgccgctaaagcactggaagaattcccacgctttaacagctccatttccgaagat
ggtcagaaactgacgctgaagaaatacatcaatatcggtgtggcggttgatacgcctaac
ggcttggtagttccagtattccgtgacgtcaacaaaaagggtattgtcgagttgtctcgt
gagctatctgtcatctccaagaaagcacgtgatggcaagctgacagcatctgacatgcaa
ggcggctgtttcactatctccagtctgggcggtatcggcggtacggcatttacgccaatc
gtcaatgcgccagaagtggctatcttgggtgtatcaaaatcatccatgaaacctgtctgg
aatggtaaagagtttgctccacgcctgatgttaccgctgtctctgtccttcgatcaccgt
gtgattgatggtgccgcgggtgcacgcttcgccgcgtatatcgctaccattatggcggat
attcgccgtctggtgatgtaa

DBGET integrated database retrieval system