KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_3497Help
Entry
YpsIP31758_3497   CDS       T00570                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ypi00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3946043..3947365)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALT
MAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNAFRKIIQNVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSADLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAHDEADARAKL
QAVLDNGKAAEVFGRMVAAQKGPVDFVERYDSYLPVATLSKPVFAEQTGIITAMDTRALG
MAVVALGGGRRRATDPIDYSVGLTEMARLGTRVDGQQPLAVIHANNEDDWQQAAEAVRAA
ITLGNNAPEETPVIYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggcacaagaaattatccgtaaaaaacgcgacggtcagccattgagcgaagaa
gagattcgtttttttatcaatgggatccgcgataacgttgtttctgaagggcaaattgcc
gctttagcgatgaccatttatttccacgatatgagtatgcctgagcgcgttgcgctgacc
atggcgatgcgtgattccggtactgtgctgaattggaagagcctgaatctgaatggcccg
ctggtcgataagcactccactggtggcgtgggtgatgtgacgtcactgatgcttggcccg
atggtggcagcttgcggcggctatgtgccgatgatctctggccgtggtcttggtcatacc
ggcggcacactggataaactggaggcgatccccggttttgatattttcccggatgataat
gcgttccgcaaaattattcagaatgttggtgtggcgattatcggccaaaccagctcgctg
gcccctgccgataagcgtttttacgcgacccgcgatattacggcaacagtagattctatt
ccattgattacggcctctatcctggccaaaaaattggcggaaggcctggatgcattggtc
atggacgtgaaggtcggctctggtgcctttatgccaacctactcgttgtcggctgatttg
gcgcaggcgattgttggtgtggcaaacggggcgggttgcaaaaccacggcgctcctgacg
gacatgaaccaagtcctggcatccagcgccggtaatggggtcgaagtccgcgaagctgtg
cgtttcctgacgggcgaatatcgcaacccacgtttgctggaagtgactatggcgctgtgt
gttgaaatgttgctgtcaggcggtttagcgcacgatgaagccgatgcccgtgccaagctg
caagccgttttggataacggcaaagcggcagaagtctttggccgcatggtggccgcgcaa
aaaggcccggtagactttgttgaacgctatgacagctacctgcccgttgctaccctaagc
aaaccggtatttgctgaacagacgggaatcattactgcaatggatacccgcgccttgggt
atggcggtggtcgccctcggcgggggacgccgtcgggcaacggatcccattgattatagt
gtagggctgacggaaatggcccgcttgggtacccgtgttgacgggcagcagccacttgcg
gtgatccatgccaataacgaagatgactggcaacaggcggcagaggctgtgcgtgcggcc
atcaccttagggaataacgcgccagaagaaacgccagtgatttatcgccgtatcactgaa
taa

DBGET integrated database retrieval system