KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_3506Help
Entry
YpsIP31758_3506   CDS       T00570                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YpsIP31758_3506 (holD)
   00240 Pyrimidine metabolism
    YpsIP31758_3506 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YpsIP31758_3506 (holD)
   03430 Mismatch repair
    YpsIP31758_3506 (holD)
   03440 Homologous recombination
    YpsIP31758_3506 (holD)
Enzymes [BR:ypi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YpsIP31758_3506 (holD)
DNA replication proteins [BR:ypi03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     YpsIP31758_3506 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3956305..3956742)
Genome map
AA seq 145 aa AA seqDB search
MASRRDLLLQQLGITQWVLRRPAVLQGEIAIHLPEDTRLLIVAQQLPEHGDPLLCDVLRS
LGLTPHQVYALTPDQVAMLPEDTQCNSWRLGISEPLAVAGAQLHSPELAGLYQDAGAKRA
LWQQICHYEADFYPDASRSGHSVPN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagacgagacttgctgttacagcagcttggcattacgcagtgggtattgcgc
cgtcctgccgtcttgcagggtgagattgcaatacatttacctgaagatacccgcctactg
attgtggcacagcaactgcctgaacatggtgatccactgttgtgcgatgtgctacgcagt
ttgggcctaaccccccatcaggtttatgccttgacgccggatcaggtcgcgatgttgccg
gaagatacgcagtgcaacagttggcgattgggcatcagtgagccgcttgcggtggccggt
gcacaattacatagcccagaattagctgggctttatcaagatgcgggcgctaagcgcgca
ctttggcagcagatttgtcattatgaagcagatttctatcctgacgccagccgatctggc
cacagcgtaccaaattga

DBGET integrated database retrieval system