KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_3511Help
Entry
YpsIP31758_3511   CDS       T00570                                 

Gene name
pemA
Definition
pectinesterase A (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YpsIP31758_3511 (pemA)
   00500 Starch and sucrose metabolism
    YpsIP31758_3511 (pemA)
Enzymes [BR:ypi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     YpsIP31758_3511 (pemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3961106..3962191)
Genome map
AA seq 361 aa AA seqDB search
MPINALSKTLLLGLISFAALGEVSAAQYNAVVSAMAQGDEFSSINAALQSAPPDSSPFVI
FLKKGVYTERLEVNRDNVTLKGEERDTTVIGANTAAGMLNPQGTKWGTSGSSTVLVNAAN
FTAENLTILNDFDFPANQAKAEGDPTKLKDTQAVALLLAEKSDKARFRQVKLEGYQDTLY
SKTGSRSYFTDCDISGHVDFIFGSGVTVFDRCNIIARDRRDISPPYGYITAPSTQNTAPY
GLIVLNSRLTKEPGVPAKSFALGRPWHPTTAFDDGRYADPAAIGQAVFINTVMDDHIYGW
DKMSGKDKQGEKVWFYPQDSRFFEANNQGPGAEINEGRRQLSAEQLKAFTLPMIFPDWTV
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaatgctctgagtaagacactattattaggattgatatcatttgccgcttta
ggtgaagtcagcgcggcacagtacaatgctgtggtttctgccatggcgcagggcgatgag
ttctcttcaattaatgcagcgttacaatcagcaccgccagatagttctccgtttgttatt
ttccttaaaaaaggcgtttataccgaacggcttgaggtcaatcgtgacaatgtgacgctg
aaaggtgaggagcgtgatacgacggtgattggcgcgaataccgccgcgggtatgctcaac
ccacaagggacgaagtggggaacctctggcagcagcacggtattggtgaatgccgccaat
tttactgcagaaaatttgacgattcttaatgacttcgatttccctgctaatcaggcgaaa
gcagagggtgatccgacgaaattaaaagatacgcaggcggtggcgctgttattagcagaa
aaaagtgataaagcccgtttcaggcaagtcaaacttgaggggtaccaagatacgctttat
agcaaaacgggcagtcgtagctactttaccgattgtgacatcagtggccacgtcgatttt
atttttggctcaggggtgacggtatttgaccgctgcaatattattgcccgtgatcgccgt
gatatctccccaccttacggttacattacggcacccagtacccaaaataccgcaccttat
ggtctgattgtcctcaatagtcgtttaaccaaagaaccaggtgtgcctgctaaaagtttt
gccttagggcgcccgtggcaccctactacagcatttgatgatggccgttatgctgatcct
gcggctatcggacaggcggtatttatcaataccgtaatggatgatcatatttatggctgg
gataaaatgtctggaaaagataagcaaggcgagaaagtttggttctatccgcaagactct
cgcttctttgaagcgaacaatcagggaccaggggctgaaattaatgaggggcggcgtcag
ttgtctgctgagcaactaaaagcgttcacattgccaatgatttttcccgactggaccgtt
cagtag

DBGET integrated database retrieval system