KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_4006Help
Entry
YpsIP31758_4006   CDS       T00570                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ypi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4497954..4500137)
Genome map
AA seq 727 aa AA seqDB search
MPVLPDRQVINQLISGHYGDPFSILGMHETSQGLQVCALLPDAQEVWLVETENGRRIAQL
TLEDPRGFFIAQLTRRKKSFRYQFAVTWQENPQIIDDPYRFGPLLQDIDSWLLAEGTHLR
PYERLGAHLMRLDGVPGVSFAVWAPNAQRVSVVGDFNFWDGRRHPMRLRRENGIWELFLP
GIEAGQLYKFEIIDCHGQVRLKADPYAFEAQMRPETASLISPLPDVVKSSAARQKANDLC
SPVSIYEVHLGSWRRHTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGSWGY
QPLGLYAPTRRYGTPEDFKAFVAKFHQAGINVILDWVPGHFPSDEHGLSTFDGTALYEYA
DPREGYHQDWNTLIYNYGRNEVRNYLAGNAFYWMERFGIDALRIDAVASMIYRDYSRAEG
QWVPNYYGGRENLEAIAFLRYTNKTIGVERPGSVTMAEESTDFPGVTLPPDIGGLGFNYK
WNMGWMHDTLNYMQCDPVHRKYHHNLMTFGMLYAYTENFILPLSHDEVVHGKRSILDRMP
GDAWQKFANLRAYYAFMWAHPGKKLLFMGCEFAQGREWNFETSLDWHLLDDENGWHSGVQ
RLVRDLNHCYRQYAPLYEWDYQPAGFEWLVVDDHENSVFAFLRRDAEGHELIAISNFTPV
PRYHYRVGIPQGGHYREVLNSDSAFYCGSNLGNQGGIDSHHVRSHNHEHSLLLTLPPLAT
IYLLREN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgccagtacttcccgatcgtcaggtgattaatcagcttatttccggccattatggcgat
cccttctccattttgggtatgcatgaaacctcgcaggggttgcaggtttgtgcattgctg
ccagatgcccaagaagtctggctagtggagacagagaacgggcggcggatagcacaatta
acgctcgaagatccccgtggtttttttattgcacaactgactcgtcgtaagaaatccttc
cgctaccaatttgccgttacctggcaagaaaacccacaaatcatcgacgatccttaccgg
ttcggtcccttattacaggatattgatagctggttattggctgaaggtacccatttacgc
ccttatgaacgcttgggggcacatttaatgcgccttgatggtgtacccggtgtcagtttt
gcggtttgggcaccgaatgctcagcgggtctccgtggtgggggattttaacttttgggat
ggccgccgtcatccgatgcgcttacggcgtgaaaatggcatttgggagctatttctgcca
ggaatagaggcggggcagttgtataagtttgagatcattgattgccatggccaggtgcgt
ctgaaagctgacccttacgcttttgaagcgcagatgcggccagaaaccgcctcattgatt
agcccgctacccgatgtagtgaagagtagcgccgcacggcaaaaagccaatgatttatgt
tccccggtgtctatctatgaagtgcatctcggttcgtggcgtcggcataccgataataat
ttctggttgagttaccgcgaattggcggatcaactggtcgaatacgttaaatatatgggt
tttacccatgtcgagctgctgccgattaacgaacatccatttgacggtagctggggttat
cagccgctaggattatatgcaccgacccgccgttacggcaccccagaggatttcaaagcg
ttcgtcgccaaattccatcaggcaggaattaacgtgatccttgattgggttcccggccat
tttcccagtgatgagcatggattatcgaccttcgatggcactgcgttgtatgaatatgct
gatccgcgcgaagggtaccatcaggattggaataccctgatctataactatggtcgtaac
gaagtccgtaactatctggcgggcaatgcattctactggatggaacgttttggcatcgat
gcgttgcgtattgatgcggtggcctcaatgatttaccgcgattatagccgtgctgaaggg
cagtgggtgcctaactattatggtggccgggaaaatttggaggctatcgctttcttgcgt
tacaccaataagaccattggcgttgaacgccccggcagtgtgaccatggcggaggagtca
accgactttcctggtgtgacattaccgcctgatattggtggcctgggtttcaactataaa
tggaacatgggttggatgcatgacacgctgaattacatgcaatgtgatcctgttcaccgc
aaataccaccataatttgatgacgttcggtatgttatacgcttataccgagaactttatc
ttaccgctctcccacgatgaagtggtccacggcaagcgctcgatacttgatcgtatgccg
ggtgatgcctggcagaaatttgccaacctacgggcttattacgcatttatgtgggcgcat
cccggtaaaaaactgctgtttatgggctgtgaatttgcgcaggggcgtgagtggaatttc
gaaaccagtctggattggcacctgctggacgatgaaaacggctggcattccggtgtgcag
cgtctggttcgtgaccttaaccattgctatcgccagtatgcgccgttgtatgaatgggat
tatcaacccgctggttttgaatggttggtggttgatgaccacgaaaattcggtattcgcc
ttcctgcgccgtgatgccgaggggcacgaactgattgctatcagtaatttcaccccggtt
ccacgttatcactaccgtgtgggcattccacaaggtggtcactaccgtgaagtgttgaat
tctgactctgcattttactgcggcagtaacctgggtaatcagggcggcattgatagccat
catgtgaggagccacaaccacgagcattcgttgttactcaccttgccaccgctggcaacg
atttacctgctgcgggagaactag

DBGET integrated database retrieval system