KEGG   Yersinia pseudotuberculosis IP31758 (serotype O 1b): YpsIP31758_4070Help
Entry
YpsIP31758_4070   CDS       T00570                                 

Gene name
bcsZ
Definition
(GenBank) endoglucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ypi  Yersinia pseudotuberculosis IP31758 (serotype O:1b)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4586251..4587366)
Genome map
AA seq 371 aa AA seqDB search
MVVMFKHLASMFLLLASFSLAAASNWPAWQQFKQDYISEGGRIIDPGSPSKITTSEGQSY
GLFFALVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADI
LIAYNLLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLN
PSYLPPQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSPDWVVWQKGKGWQPDTIKPDV
GSNDAILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGSVG
FSAALLPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQ
GELQPSWHRQR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcatgtttaaacacttagccagcatgttcctgttgctggccagttttagtctc
gcagccgccagtaactggcccgcgtggcaacagttcaaacaagattacatcagtgaaggg
gggcggatcattgaccccggtagcccctcgaaaataaccacctcggaaggccagagttat
gggcttttttttgcattggttgcggatgatcagccgatgtttgagcgtttattggcttgg
acagaaaacaatctggcagccggtgatctcacttcccgccttcccgcttggttatggggg
caaaactcacaaaataactgggatattctggaccctaattcggcctccgatgcggatatc
ttgattgcctacaacttgctggaggctggcaggttatggggtaaccgccgttacctgatt
atgggtaccttattactgcaacgtattgcgcaagaagaagtcatggatattcccggcctt
ggccagatgctattaccgggaaaaattggttttaacgatgaggatacctggcgtctcaac
ccaagttatttaccgccacaactactggcacgattttcctccatagacgggccttgggaa
gcgatggtagaagtgaatcagcgtatgtggctggaaaccgcaccaaacggtttttcgccg
gactgggtggtctggcagaaaggtaaaggctggcagcccgataccataaaaccggatgtc
ggcagtaacgatgccattctggtttatctgtgggcggggatgctggcaatggacagccca
caaaaagctgaattgattgcgcgttttcagccaatggcggtaatcactcagcagcaaggc
ctgccaccgtttacgaccaacagcgacaatggtaaaactaacggggatgggtcagtgggt
ttttctgcggcattattgccctttttagccagcagcccagagccatttaatcagcaaaca
ctgaatctccaacagcgacgggtacaaaattcaccgcctggcgctgatgattattacagt
gctattctgaccctgtttggtcaggggtggttacagcatcgttatcattttacccatcag
ggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system