KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0008Help
Entry
y0008             CDS       T00092                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    y0008 (rbsK)
Enzymes [BR:ypk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     y0008 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8116..9042
Genome map
AA seq 308 aa AA seqDB search
METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGANQAVAAGRSGADIAFI
ACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVNSDGENVIGINAGANSAVT
PEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQTQVILNPAPARKLPDELLTLV
DMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIITLGSRGVWLSEQGKGKLVA
GFKVNAVDTIAAGDTFNGALLTALLEGQSMDVAVRFAHAAAAIAVTRPGAQPSIPWRAEI
DSFLQERV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggtaagctggtggtgttgggcagtatcaatgccgaccatattctgaatatt
gagcagtttccacgtccgggtgaaacggtgatcgggcagcagtataacgttgctttcgga
ggtaaaggggctaatcaagcggttgctgctggccgtagcggtgcggatatcgcatttatt
gcctgtgtgggtgacgatgatattggtgaacgggtgcgtcagcaactcactgccgataag
attgatactcagcctatcgaggctattaagggggcaactaccggtgtggcattgatcttc
gtgaatagcgatggcgaaaatgtgattggtattaatgcgggggctaactcagcggtgaca
ccagagtatcttcgccgctaccaacaacaagtgatcgatgctgatgcactcttaatgcaa
ctggagtcgccgctcgacactgttattgcggccgctaaactggcgaagcagcatcaaact
caggttatcctcaatccggcacccgcccgtaaattacccgatgaattattaactctggtc
gatatgattacgcctaatgaaacggaagccgagcgtttgaccggcattcatattgagcag
gatgatgatgccgcgaaagcagcgcaaattttgcatgataaaggcattgctaccgtgatc
atcaccttaggtagccgtggcgtatggctcagtgaacaaggtaaaggtaaattagtggcg
gggttcaaggtaaatgccgtagataccattgctgccggtgatacgtttaacggtgcatta
ttgacagcgttattagaaggccagtctatggatgtcgcagtgcgttttgctcatgccgcg
gcggctattgcggtcactcggcctggagcacagccgtccattccatggcgtgccgaaatt
gatagcttcttacaagaacgagtgtaa

DBGET integrated database retrieval system