KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y0015Help
Entry
y0015             CDS       T00092                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ypk01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ypk00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ypk00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19456..21087
Genome map
AA seq 543 aa AA seqDB search
MAAVTLGRGIAMRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQLLAT
RASWQQTIDQGALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVINALNAN
VKVFMADFEDSLAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLIARVRGL
HLPEKHVKWQDEAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAAWWSDVFN
FTEQRFGLSQGTIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNH
PDRVLPDRQSVTMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEKNKLVLDKVR
ADKELEASNGHDGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPITAAELLEPCS
GERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKSLSN
GQTVTKELFRSMLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQDELIDFLTLPGYA
LLA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcagtaacattgggaaggggaatagcaatgagacaacagttagcgggcacagag
ttagttttcacccagccttttaatgctgctgagcggcaggttttaccggataaagccatc
gagtttctaaccgaattagtggtgaaatttagcgaatcgcgtaaccaactccttgccaca
agggcatcttggcagcaaaccatcgatcagggggcgttacccgattttattttggaaact
aattccattcgtgatggtgattggaaaatccaaggtattcctgctgacttacgcgatcgt
agagttgagatcaccgggccagtagagcggaaaatggtgatcaatgcgcttaatgccaac
gtaaaagtttttatggcggatttcgaagattcactggcacccagttgggataaagtgatt
gatggtcaaattaatctacatgatgcggtgaaagggacaatttcctatacgaatgaatcg
ggcaaggtctatcaattaaaacctaatcccgcggtattgattgcacgtgttcgtggcctg
cacttaccggaaaaacatgttaaatggcaggacgaggcgattcccggtggtttattcgat
ttcgctttgtatttctaccataactatcagcaactgctggcgaagggcagcggcccttat
ttctatttgccgaagatgcagtcataccaggaagccgcttggtggagcgatgtgttcaat
tttaccgagcagcgctttggtctatcgcagggcaccattaaggcgacggtattaattgag
acattacccgccgttttccaaatggatgaaattctctaccacctgcgccaccacattgtt
ggtctgaattgtgggcgctgggactatatctttagctatataaaaacattgaaaaaccac
cctgaccgcgtgttaccagatcgccagtcagtcacgatgaataaaccttttcttagcgcg
tattcccgtttgttgatcaagacatgccataaacgtggcgctttggcgatggggggaatg
gccgccttcatcccggataaagacgcagaaaagaataagttggtgttggataaagttcgt
gccgacaaagagttagaagccagtaacggccacgatggaacttgggtggcgcatccgggc
ttggcagatacggtgatggacgtttttaacaaagtattaggttctcggcctaatcaatta
gaggttagccgcgaacaggataaacctatcaccgccgctgagttgctggaaccttgttct
ggcgagcgcactgaagcagggatgcgggccaatatcagagtcgcggtgcagtacattgaa
gcatggatatcgggtaatggttgtgtgccgatttatggcttgatggaggatgcggctact
gcagagatttcccgcacttctatctggcaatggatacatcatcagaaaagcctcagtaat
ggccagacggtgactaaagagctgttccgcagcatgttgagtgaagaaattcaggttgtg
aagcttgagcttggcgcagagcgttttgatcgcgggcggtttgaagaagctgcacgcttg
atggagcgtattacaacacaagacgagcttatcgacttcctgacgttgccgggctatgca
ttgcttgcctga

DBGET integrated database retrieval system