KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0015Help
Entry
y0015             CDS       T00092                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00620  Pyruvate metabolism
ypk00630  Glyoxylate and dicarboxylate metabolism
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
ypk01200  Carbon metabolism
Module
ypk_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    y0015 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    y0015 (aceB)
Enzymes [BR:ypk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     y0015 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AAM83611
UniProt: Q8D1U4
Position
19456..21087
Genome map
AA seq 543 aa AA seqDB search
MAAVTLGRGIAMRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQLLAT
RASWQQTIDQGALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVINALNAN
VKVFMADFEDSLAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLIARVRGL
HLPEKHVKWQDEAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAAWWSDVFN
FTEQRFGLSQGTIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNH
PDRVLPDRQSVTMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEKNKLVLDKVR
ADKELEASNGHDGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPITAAELLEPCS
GERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKSLSN
GQTVTKELFRSMLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQDELIDFLTLPGYA
LLA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcagtaacattgggaaggggaatagcaatgagacaacagttagcgggcacagag
ttagttttcacccagccttttaatgctgctgagcggcaggttttaccggataaagccatc
gagtttctaaccgaattagtggtgaaatttagcgaatcgcgtaaccaactccttgccaca
agggcatcttggcagcaaaccatcgatcagggggcgttacccgattttattttggaaact
aattccattcgtgatggtgattggaaaatccaaggtattcctgctgacttacgcgatcgt
agagttgagatcaccgggccagtagagcggaaaatggtgatcaatgcgcttaatgccaac
gtaaaagtttttatggcggatttcgaagattcactggcacccagttgggataaagtgatt
gatggtcaaattaatctacatgatgcggtgaaagggacaatttcctatacgaatgaatcg
ggcaaggtctatcaattaaaacctaatcccgcggtattgattgcacgtgttcgtggcctg
cacttaccggaaaaacatgttaaatggcaggacgaggcgattcccggtggtttattcgat
ttcgctttgtatttctaccataactatcagcaactgctggcgaagggcagcggcccttat
ttctatttgccgaagatgcagtcataccaggaagccgcttggtggagcgatgtgttcaat
tttaccgagcagcgctttggtctatcgcagggcaccattaaggcgacggtattaattgag
acattacccgccgttttccaaatggatgaaattctctaccacctgcgccaccacattgtt
ggtctgaattgtgggcgctgggactatatctttagctatataaaaacattgaaaaaccac
cctgaccgcgtgttaccagatcgccagtcagtcacgatgaataaaccttttcttagcgcg
tattcccgtttgttgatcaagacatgccataaacgtggcgctttggcgatggggggaatg
gccgccttcatcccggataaagacgcagaaaagaataagttggtgttggataaagttcgt
gccgacaaagagttagaagccagtaacggccacgatggaacttgggtggcgcatccgggc
ttggcagatacggtgatggacgtttttaacaaagtattaggttctcggcctaatcaatta
gaggttagccgcgaacaggataaacctatcaccgccgctgagttgctggaaccttgttct
ggcgagcgcactgaagcagggatgcgggccaatatcagagtcgcggtgcagtacattgaa
gcatggatatcgggtaatggttgtgtgccgatttatggcttgatggaggatgcggctact
gcagagatttcccgcacttctatctggcaatggatacatcatcagaaaagcctcagtaat
ggccagacggtgactaaagagctgttccgcagcatgttgagtgaagaaattcaggttgtg
aagcttgagcttggcgcagagcgttttgatcgcgggcggtttgaagaagctgcacgcttg
atggagcgtattacaacacaagacgagcttatcgacttcctgacgttgccgggctatgca
ttgcttgcctga

DBGET integrated database retrieval system