KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0052Help
Entry
y0052             CDS       T00092                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    y0052 (tpiA)
   01230 Biosynthesis of amino acids
    y0052 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    y0052 (tpiA)
   00051 Fructose and mannose metabolism
    y0052 (tpiA)
   00562 Inositol phosphate metabolism
    y0052 (tpiA)
Enzymes [BR:ypk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     y0052 (tpiA)
Exosome [BR:ypk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   y0052 (tpiA)
  Exosomal proteins of bladder cancer cells
   y0052 (tpiA)
  Exosomal proteins of melanoma cells
   y0052 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64443..65210
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system