KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y0101Help
Entry
y0101             CDS       T00092                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ypk00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
107994..108617
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVSEK
EFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDIDWQGAQQIRAKMPTARS
IFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHYAEYDYLIVNDDFNLALSDLK
TIIRAERLRLGRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggtacgctatacatagtttccgcgcccagcggggcagggaaatcaagcctg
attcaggctttgttaaaaacacaaccgctgtacgacacgcaggtttcaatttcccatacc
acgcgtgctaaacgtccaggggagaatcacggcgagcattacttctttgtttctgaaaaa
gagttttgccagatgattgatgatgatgcttttcttgagcatgccaaagtatttgaaaat
tactacggtacctcacgtctggctattgagcaggttcttgcaaccggggttgatgtcttt
ttagatattgactggcaaggagcgcaacagattcgcgcaaaaatgccaaccgctcgcagt
attttcatcttgccgccatccaaaacagaattggatcgccgtttacgcggtcgtgggcag
gatagcgaagaagttatcgctaagcgtatggagcaagctgtcgcagagatggcccattac
gcagagtatgattatttaatcgtaaatgatgatttcaatctggctttgtctgatctgaaa
accattattcgcgcagaacgactgcgtttaggccgccagaaacagcggcatgacgcttta
atcagcaaattattggcggactga

DBGET integrated database retrieval system