KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0161Help
Entry
y0161             CDS       T00092                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase, catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00240  Pyrimidine metabolism
ypk00250  Alanine, aspartate and glutamate metabolism
ypk01100  Metabolic pathways
Module
ypk_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    y0161 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    y0161 (pyrB)
Enzymes [BR:ypk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     y0161 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace BRCT
Motif
Other DBs
NCBI-ProteinID: AAM83755
UniProt: Q8ZB39
Structure
PDB: 

Jmol
Position
166338..167273
Genome map
AA seq 311 aa AA seqDB search
MANPLYHKHIISINDLSRDELELVLRTAASLKKTPQPELLKHKVIASCFFEASTRTRLSF
ETSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIVMRHPQEGASRLAAQFS
GNVPIVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGDLKYGRTVHSLTQALAKF
NGNHFFFIAPDALAMPAYILQMLEEKEIEYSLHESLEEVVPELDILYMTRVQKERLDPSE
YANVKAQFILRSSDLTGARDNLKVLHPLPRIDEITTDVDKTPYAYYFQQAGNGIFARQAL
LALVLNAELAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccgttgtatcacaaacatatcatctcaattaacgatttaagtcgcgatgaa
ctagaactggtcttgcgtactgcggccagcctgaaaaagactccgcagccagagttgtta
aaacataaagtgatcgccagttgcttttttgaagcgtcgacccgcacccgcttgtcattt
gaaacatccattcaccgcctgggtgcctcggtcgtgggcttttctgatagcagcaatacc
tcattgggtaagaaaggcgagacactggcagacaccatgtcagtcattagcacttatgtt
gacgccattgtgatgcgccatccacaagaaggggcttcacgtctggccgcgcaattctcg
gggaatgtgcctatcgtgaatgccggtgacggcgcaaaccagcacccaacacaaaccctg
ctcgatttattcactattcaggaaacgcagggccggctggataacatcaatatcgccatg
gtaggtgacctgaaatatggccgtaccgtgcattcattgacgcaagcgctggcaaaattc
aatggcaaccacttcttctttatcgcccctgatgcgctggcaatgcccgcttatattttg
caaatgttggaagaaaaagagattgagtacagcctgcatgaaagcctcgaagaggtggta
ccggagttagatattctctatatgactcgcgtacagaaagagcgccttgacccatcggaa
tatgccaatgtcaaagcacagtttattttgcgctcttctgatttaacgggcgcacgggat
aatcttaaagtgttgcacccgctgccacgtattgacgaaatcacaaccgatgtcgataaa
accccctacgcctactatttccaacaagcgggtaacggtatttttgcacgtcaggcgcta
ctggcactggtattaaacgcagaattagctctttaa

DBGET integrated database retrieval system