KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0248Help
Entry
y0248             CDS       T00092                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    y0248
Enzymes [BR:ypk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     y0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
263804..264736
Genome map
AA seq 310 aa AA seqDB search
MMSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAVQAVRLGAEVAYAGV
VGDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARNVIVVDMGANKLFTPA
LVDSALSQLKQSNVVLTQLEIPLETARYGLQRAKEFGKITILNPAPARDLRGLDLSAIDY
LTPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGESGSAVFGRNDTQEIPPC
IIDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALCCMDWETVPSYRYREDVDA
FMRSITVKEE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagtgtatttattctcggcagctatgcgaaagcgctggtgatgaccaccgaccgt
attcctctggctggggaaacgctgattggctatgactttcgccagacgtggggcggtaaa
ggctcggatatggcggttcaggcagtgcgtctgggggcagaggtcgcctatgcgggtgtc
gtcggtgatgacacctttggccatgaatttgtcggcttgatgcaggaagaaggcgtcaat
atcgacgcattaaccatcagcggagaattaccaacgggggcgggacttatcgttaaagat
aaagaagcccgtaacgtgattgtcgtggatatgggggccaataaactgtttaccccagcg
ttggtggacagcgccttatcccagctcaaacaaagcaatgtggtgctcacacagcttgaa
attccgctggaaacggcacgttacggactccaacgggcaaaagaattcggcaaaataacc
atcctgaacccggctccggcaagggatctgcgcggtctcgatctcagcgcgattgattat
ttgacccctaatgaaacggaagcccgcgtggctctgggtctgcctccggatgacccacgc
agcaaccgagagattgccaacctcttactggaaaccggttgccaatatgtcgtgatgacg
ctgggtgaatcaggttctgcggtatttggtcgcaacgacacacaagaaatccccccctgc
atcattgatgtcgtcgacagtaacggtgcaggtgacagctttaacgcggcactggccgtc
gcgctggatgaagggctgccgattagcgaagctgtgctgtttgctaacgccacggcggcg
ttgtgctgtatggattgggaaacggttccgtcctatcgctaccgcgaagatgtcgatgct
tttatgcgatctataaccgtgaaagaggaataa

DBGET integrated database retrieval system