KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0279Help
Entry
y0279             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11894  
type VI secretion system protein ImpI
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   y0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(299092..300408)
Genome map
AA seq 438 aa AA seqDB search
MDKKQPTLSLRVVNSDKLESGKQASSLFHTQGGSVGSDGSHHWSIQDQGGNISPSQFAIE
WRDGSFCLRMLNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVIKSHISRSAADMIDPLM
VSPESLVSSYSNPMDAMMEGEPLASPHHQQDSRLAATVSHNFSHDPLRVLETESLTTQGH
DAVISDADHSLQQDRYRNPLFSSPLSDTPKDSAMDQAFIDLPQISTFLNGKQAGGKPEGL
NNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKTLKATIEGLLALQRSQHGLRD
KHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAVAESLDNLRLHHQANQQAITQ
ALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMYKNYYNELASSRQQGFEKLFGE
VYEQAYDRALRQGMKDSE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaacaaccaacgctgtcattgcgggtcgtcaacagcgataaattagagagt
ggcaaacaagccagcagcctgtttcatacgcaagggggcagtgtcggcagtgacggtagc
catcattggtcgattcaggaccaaggcggcaatatcagcccgtcacagtttgctattgaa
tggcgtgatggctctttctgcctgcggatgctgaatggctctctgaacattaatcattcg
atgctgacacccaattcgggtttcgttcgcctacagcaaggggatgaaatgacgttgggt
aatctggtgatcaaaagccatatcagccgttctgctgccgatatgatcgatccactgatg
gtgtcaccggagtcactggtatcgagttacagcaacccgatggatgccatgatggaaggg
gagccgttggcctcgcctcatcatcagcaagacagccggttagccgcgacggttagccat
aatttcagccatgatccattgcgggtattggaaactgaaagcctgaccacgcaaggccat
gacgccgtgatatctgatgctgatcactctctacagcaggaccgataccgtaacccactt
ttctcttccccgctctctgatacccccaaggacagtgctatggatcaggcgtttatcgat
ctcccgcagatcagtacctttcttaacggtaaacaagcggggggcaaaccagaaggatta
aataaccaaatggaacaacatcacgttgccattacgccgctgatgcgtggttttgacgct
caactcccgatccgcaacagccaggaagctcacgatttccttgaagaggcgggtaaaaca
ctcaaagcgacaatcgaaggtctgctcgccttacaacgcagccaacatggcttgcgtgat
aagcacttacggccgattgaagataatccattgcgtctgaatatggattacgacaccacc
ctcaacttgatgtttgccgatcaaaaaagcccggttcatctttcagcgcccgccgccgtg
gccgaaagcctggataacctgcgtttgcatcatcaggccaatcaacaggcgattacgcaa
gccttgaacaccatgttggaagccttctcccctgagcgtttactgacgcgttttacccat
tatttgcgcagtaatgagcggcaagagcaggactccgcctgggcgtgggatatgtacaaa
aactactataacgagctggcctccagccgccagcaaggttttgaaaaactgtttggcgaa
gtgtatgagcaagcctatgaccgggccttacgtcaaggcatgaaggatagcgagtaa

DBGET integrated database retrieval system