KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0291Help
Entry
y0291             CDS       T00092                                 

Definition
(GenBank) hypothetical
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
310544..310975
Genome map
AA seq 143 aa AA seqDB search
MAHLNARFDDKEGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQQLAVFRKVP
RGMRQEPVLSPVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLGGTLRLPFGRQM
CAASGDTEFFSQAPVGPATNEVQ
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtggctcacctcaacgcccgttttgacgataaagaggggctattcgaaggtgcatcacaa
agcggtactttgctgatattacgtaatattagcgctcgagcctgccaggttaatgcaatg
ccagtgatcagtttcgaaggcgcagttggccagcagttggccgtctttcgcaaagtaccg
cgtgggatgcggcaggagccggtactctcacccgtcactgttgcggcgggagctgaagtc
gcggtgcaattgcgttgggtggccagtgacgcgttcgatgggaataactgtgtaacacct
gagaaagtggtggtgaccctgctaggggggacattgcgtttacctttcggccgacagatg
tgtgcggcatctggtgatactgaattcttcagtcaggcaccagtaggcccagcgaccaat
gaggtgcaatga

DBGET integrated database retrieval system