KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0292Help
Entry
y0292             CDS       T00092                                 

Gene name
menG
Definition
(GenBank) 2-heptaprenyl-1,4-naphthoquinone methyltransferase
  KO
K02553  
regulator of ribonuclease activity A
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Messenger RNA biogenesis [BR:ypk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     y0292 (menG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(311092..311577)
Genome map
AA seq 161 aa AA seqDB search
MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFEDNGLLFDLLEENGLGRV
LVVDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDLAELDIGIQAMAAIPVGAA
DEGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgatacttccgatctctgtgacatctatcatgaagaggtaaacgtggtagaa
ccactgttctccaattttggtgggcgcacttcatttggtggcaagattactaccgtaaaa
tgtttcgaagataacggcttgttgtttgacctgcttgaagagaatggtcttggccgtgtc
ttggtcgttgatggcggtggttcagtgcgccgtgcattaatcaatgctgagctagccgaa
ttagccttgaaaaacgagtgggaaggcattgttgtttacggtgccgtgcgtcaggtcgat
gacttggccgagttggacattggcattcaggcaatggccgcaatacccgtcggggctgct
gatgagggtgtgggtgagagcgatatccgtgttaattttggcggtgtaacgttcttctca
ggtgaccatctttatgccgataacaccggtattatcttatcggaagatcccctggatatt
gaataa

DBGET integrated database retrieval system