KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0295Help
Entry
y0295             CDS       T00092                                 

Gene name
hslV
Definition
(GenBank) heat shock protein, proteasome-related peptidase subunit
  KO
K01419  
ATP-dependent HslUV protease, peptidase subunit HslV [EC:3.4.25.2]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.2  HslU---HslV peptidase
     y0295 (hslV)
Peptidases [BR:ypk01002]
 Threonine Peptidases
  Family T1: proteasome family
   y0295 (hslV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(314274..314798)
Genome map
AA seq 174 aa AA seqDB search
MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVIAGFAGGTADAFTLFEL
FERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADETASLIITGNGDVVQPEDDL
IAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDICIYTNRFQTIEELTY
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacaattgtaagtgtacgccgtgatggtcatgtcgttattggtggcgatggccaa
gtcactttgggcaataccgtgatgaaaggtaatgccaaaaaagtccgccgtctttataac
aacaaggttattgctggctttgcgggggggactgctgatgcctttactctgttcgagtta
tttgaacgcaagctggaaatgcatcaaggccacctgacgaaagcggctgttgaactagcc
aaagactggcgcaccgaccgtatgctgcgcaagcttgaagcgttactggcggttgccgat
gagaccgcttcgctgatcattactggtaacggtgacgtggttcaacctgaagatgatctg
attgccattggctccggtgggccttatgcccaatcggcagcacgtgcgttgttagaaaat
actgaattaggtgcgcgggatatcgttgagaaatcactgagtattgcgggggatatttgt
atctacaccaaccgcttccaaaccattgaagaattaacatactaa

DBGET integrated database retrieval system