KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0301Help
Entry
y0301             CDS       T00092                                 

Gene name
metJ
Definition
(GenBank) repressor of all met genes but metF
  KO
K03764  
MetJ family transcriptional regulator, methionine regulon repressor
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Transcription factors [BR:ypk03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    y0301 (metJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(321175..321492)
Genome map
AA seq 105 aa AA seqDB search
MAEWNGEYVSPYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE
AFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWEY
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtggaacggcgagtatgtcagcccttacgctgaacacggcaagaaaagcaag
caggtcaaaaaaatcacggtatccattccgttgaaagtgttaaaaatcctcaccgatgag
cggacccgccgtcaggtgaataacctgcgccatgctaccaacagtgaattgttgtgtgag
gcctttttgcatgcatttactggccagccgctaccgaatgacgaagacctgcgtaaagaa
cgcagtgatgagatcccggaagccgcgaaaattttaatgcgtgaattgggtgttgaccct
gacacctgggaatattga

DBGET integrated database retrieval system