KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0304Help
Entry
y0304             CDS       T00092                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  
methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    y0304 (metF)
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     y0304 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
325700..326584
Genome map
AA seq 294 aa AA seqDB search
MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSSIDRLSTLKPKFVSVTY
GANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDIAIDYWNSGIRHIVALRGD
LPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAKSAQADLINLKRKIDAGANRA
ITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQRFATMTNVRVPNWMTSIFD
GLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYTLNRAELSYAICHTLGVRP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttttcacgcaaaccagcgagaagcgctgaaccagagtctgtctgagctacaa
ggtcagattaatgtttcttttgagttcttcccgccgcgcaccagcgagatggaggatacc
ctgtggagctcgattgatcgtcttagcacgttgaaacctaaatttgtttccgtgacctat
ggggcgaactcgggtgagcgtgaccgtactcacagcatcatcaaagggattaaggagcgc
acaggcctggaagctgcgccgcatctgacctgtattgatgcttctccgactcagttgcgt
gatatcgcgattgactactggaatagcggtatccgacatatcgttgccttacggggtgat
ttgccgccaaacagcggaaaacccgaaatgtatgcctgcgatttggtgggtttgctaaaa
gatgtgggtgattttgatatctccgtggcggcgtacccagaaattcatccagaagcgaaa
agcgcccaagctgacttgatcaatctgaaacgtaagattgatgcaggtgctaaccgggcc
atcacccaatttttctttgacgttgagagttacctgcgttttcgtgaccgctgtgttgcc
accgggattgacgttgagatcgtaccgggcattttgccggtttctaattttaagcagtta
cagcgttttgccaccatgaccaatgtgcgggtcccaaattggatgacatctatttttgac
ggtctggataatgacccagagacgcgcaaaatggtgggggcatcggtcgcgatggacatg
gtgaagatcctcagccgcgaaggggtgaaggatttccatttttatacgttgaaccgggct
gagttgagttatgcgatttgtcatacccttggggtgaggccttag

DBGET integrated database retrieval system