KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0305Help
Entry
y0305             CDS       T00092                                 

Definition
(GenBank) putative transposase
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(326762..327361)
Genome map
AA seq 199 aa AA seqDB search
MNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLKWCTDVTEFRVGAQKLYLS
VIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGLMLHSDQGWHYRTPMWRSML
VEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDSATVLKRDIVEYIHYYNTERI
SLKTGGMSPAEYRTQVEKQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcacgggttactcagcctcattcggcggaaaaaatatcgctcctatagggcc
gatggtggccgggcatccgataatctattggctcgtaattttacatccgaaatcagtgga
ttgaagtggtgtacagatgtcacagagttccgagttggagcacagaagctgtatttgtcg
gtgatacaagacctgtttaataatgagattatttcttggcatatgtcagaaagagcagca
ttaatcctgacgtgcaagacgctggaaaaagcgctgaaagtgaaagggagaaaagaaggc
ctgatgttgcacagcgatcagggctggcattaccgaacgccgatgtggcgctcaatgctt
gtcgaggcggggataaggcaaagtatgtcacgcaaaggcaattgtttagataatgcagtg
atggaaaatttcttcagtcacctgaaagccgagatgtatcaccgtaagaagtacgattca
gccacagttttaaagcgtgacattgtagaatatatccattattacaatacagagcgcatt
agcctgaaaacaggcggaatgagtccggcagaataccggactcaggtagaaaagcagtaa

DBGET integrated database retrieval system